KEGG   Chloroflexus aggregans: Cagg_3701Help
Entry
Cagg_3701         CDS       T00824                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cag  Chloroflexus aggregans
Pathway
cag00260  Glycine, serine and threonine metabolism
cag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
cag01130  Biosynthesis of antibiotics
cag01230  Biosynthesis of amino acids
Module
cag_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cagg_3701
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cagg_3701
Enzymes [BR:cag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cagg_3701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACL26537
UniProt: B8GAG2
Position
complement(4497874..4499064)
Genome map
AA seq 396 aa AA seqDB search
MQDVVSRPGRFGPYGGRYVPETLMPAVSALEEAYEAAKADPSFWEELAALHRTYTGRPTP
LTFAARLTAHCGGARIYLKREDLAHTGAHKINNALGQGLLAKRMGKRRVIAETGAGQHGV
ATATVCALLGLECVVYMGVDDMARQRPNVFRMRLLGAEVRGVSSGSRTLKDAINEAMRDW
VTNPDSYYLLGSALGPHPYPTMVRDFQRVIGIEAREQIIAATGRLPDMVIACVGGGSNAI
GIFHPFLDDPEVALRGVEAGGRGERLGEHAARFRAVTPGVLQGTFSYVLQDEFGQIALTH
SVSAGLDYASIGPEHAWLHDTGRATYTAAGDDEALAAFQLLAKLEGIIPALESAHAVAEA
IKVAPTMRPDQTILVNLSGRGDKDIFTVADLLGVEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgttgtttcacgaccgggacgattcggtccatatggtggtcggtatgtacct
gaaacgctgatgccggcggttagtgcgttagaggaggcgtatgaagcagccaaagccgat
ccatcgttttgggaagaattagcagccctccaccgcacctataccggtcgaccaacaccg
ttaacctttgccgcccgattaactgcccactgcggtggcgcacgcatctatctcaagcgc
gaagatttggcccataccggcgcacacaagatcaacaatgcgctcgggcagggcttgttg
gcgaaacgaatgggcaagcggcgcgtgattgccgaaaccggcgccggtcagcatggggta
gcgactgccaccgtctgcgcgttgctcggtctggagtgcgtggtctatatgggggtcgat
gatatggcccgccagcgtcccaatgtcttccgtatgcggttgctgggggctgaagtacgt
ggggtgagcagtggttcacgcacgttaaaagacgcgatcaacgaagcaatgcgcgattgg
gtgacgaatccggacagctattacctgcttggctcggcgctggggccgcacccctacccg
accatggtgcgcgactttcagcgcgtcatcgggattgaagcgcgcgagcaaatcatcgct
gccaccggtcggttgcccgatatggtaattgcctgtgtgggcggtggctcgaacgccatc
ggtatctttcacccgttcctcgacgatcctgaggtagcgttgcgtggcgttgaagccggt
ggacgcggtgaacgactcggtgaacatgccgctcgctttcgtgccgtgactcccggtgtg
ctgcagggcaccttttcgtatgtgctacaagacgagttcgggcagatcgcgcttacccat
tcagtcagtgccggcttggattatgccagcatcggtcccgaacacgcatggctccacgat
actggacgggcgacctacactgctgccggtgatgacgaggcgttggccgcgttccagtta
ttggccaagctcgaagggattatcccagcattagagagtgcccacgcggtggccgaggcg
atcaaggtcgccccgacaatgcggcctgatcagaccattctggtgaacttatcggggcga
ggcgataaagatatctttaccgtcgctgatctgttaggggtcgaaatctag

DBGET integrated database retrieval system