KEGG   Chloroflexus aggregans: Cagg_3722Help
Entry
Cagg_3722         CDS       T00824                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cag  Chloroflexus aggregans
Pathway
cag00020  Citrate cycle (TCA cycle)
cag00310  Lysine degradation
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
cag01120  Microbial metabolism in diverse environments
cag01130  Biosynthesis of antibiotics
cag01200  Carbon metabolism
Module
cag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cagg_3722
  Amino acid metabolism
   00310 Lysine degradation
    Cagg_3722
Enzymes [BR:cag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cagg_3722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACL26558
UniProt: B8GAI3
Position
complement(4528984..4530393)
Genome map
AA seq 469 aa AA seqDB search
MAYEIRVPSLGESIVEATVARWLKREGEAVAIGEPVVELETDKVNLEVAADQSGVLVSIA
SPEGTTVAIGDLLGTIEAGALPKPSPAPTPAAAPATSAPTPAAAPATPAPTPAAAPATPA
PTPAAAPATDEVLATPVAQRMAAEHAIDLRTVQGTGPGGRVTKEDIMRLVSGTGPSEAVA
KADDSRMKVSHPTPAVIETAPPRPTPPPAPTTPPPAPATPPRPTPPPATPVMTTNGDRRE
ERQRLSRRRLTIARRLVEAQHTAAMLTTFNEVDMSAVMALRARHKDSFKERHGVSLGYMS
FFTKAVVGALKAFPMVNAEIQGEEVVIKYYYDIGIAVGVDEGLVVPVVRDADRKTFAQIE
REIAQLAKKAREGTLSLAELQGGTFTITNGGVYGSLMSTPILNAPQVGILGMHKIEERPV
VVNGQIVIRPMMYVALSYDHRLIDGSTAVRFLVKVKELIEDPEALLLEG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgaaattcgagtgccgtcactcggtgaatcgattgtcgaggcgacggtcgca
cgctggttgaagcgtgaaggcgaagcggttgcaatcggcgaaccggtcgttgaattagag
accgacaaggtgaaccttgaggtagccgccgatcagagcggggtgttggtgagtattgcc
agccccgaaggaactacggtcgcgattggcgatctgcttggtacgattgaggccggtgcc
ctacctaagccgtccccggccccaacaccggcagcggcgccagccacctctgccccaaca
ccggcagcggcgccggccaccccggccccaacaccggcagcggcgccggccaccccggcc
ccaacaccggcagcggcgccggccaccgatgaagtcttggcgacaccggtagcgcagcgg
atggctgccgaacatgccattgatttgcgcaccgtgcagggaaccggccccggcggacgg
gtaacaaaagaagacattatgcgactcgtttcaggtacgggaccaagtgaggccgtcgcc
aaagctgacgattcgcggatgaaggttagccatccgaccccggcggtgatcgagacagcg
ccaccgcggccaacgccgccgccggctccgaccaccccgccaccggctccggctacccca
ccacggcctacacccccgcctgccacaccggtgatgacaaccaatggcgaccgacgtgaa
gagcggcaacgtctgagccgtcggcgcttgaccatcgcccgccgtttggttgaggcgcag
cataccgcggcgatgctgaccacctttaacgaggtggatatgagtgccgtgatggccctg
cgtgctcgtcacaaggactcgtttaaagagcggcacggggttagccttggctatatgtcg
ttcttcaccaaggctgttgtcggtgcgctcaaagccttcccgatggtcaacgccgagatt
cagggcgaagaggttgtgatcaagtactactacgacatcggcattgcggttggggttgat
gaggggttagtcgtgccggtggtgcgcgacgccgaccgcaagaccttcgcgcagatcgag
cgagagatcgcacaattggcgaagaaagcgcgcgagggcacgctgagccttgccgagttg
cagggtggtacgttcacgatcacgaacggcggcgtctacggctcgttgatgagtacgcca
atcctcaatgcgccgcaagtcgggatcctcggcatgcacaagatcgaggagcgaccggtc
gtggttaatgggcaaatcgttattcgcccgatgatgtacgttgccctcagttacgaccat
cgcctgatcgatgggagcaccgccgtgcgcttcctcgtcaaggtgaaggagttgattgag
gatccggaagcgttgctgctagagggctga

DBGET integrated database retrieval system