KEGG   Clostridium autoethanogenum: CAETHG_0427Help
Entry
CAETHG_0427       CDS       T02883                                 

Definition
(GenBank) Propanoyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cah  Clostridium autoethanogenum
Pathway
cah00071  Fatty acid degradation
cah00280  Valine, leucine and isoleucine degradation
cah00362  Benzoate degradation
cah00620  Pyruvate metabolism
cah00630  Glyoxylate and dicarboxylate metabolism
cah00640  Propanoate metabolism
cah00650  Butanoate metabolism
cah00900  Terpenoid backbone biosynthesis
cah01100  Metabolic pathways
cah01110  Biosynthesis of secondary metabolites
cah01120  Microbial metabolism in diverse environments
cah01130  Biosynthesis of antibiotics
cah01200  Carbon metabolism
cah01212  Fatty acid metabolism
cah02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAETHG_0427
   00630 Glyoxylate and dicarboxylate metabolism
    CAETHG_0427
   00640 Propanoate metabolism
    CAETHG_0427
   00650 Butanoate metabolism
    CAETHG_0427
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CAETHG_0427
   00072 Synthesis and degradation of ketone bodies
    CAETHG_0427
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CAETHG_0427
   00310 Lysine degradation
    CAETHG_0427
   00380 Tryptophan metabolism
    CAETHG_0427
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CAETHG_0427
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CAETHG_0427
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CAETHG_0427
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cah04147]
    CAETHG_0427
Enzymes [BR:cah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CAETHG_0427
Exosome [BR:cah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAETHG_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGY74656
UniProt: U5RPF0
Position
complement(465786..466985)
Genome map
AA seq 399 aa AA seqDB search
MREVGIVGVGHTNFGKFSGGTFIDMISMAAVEALDDAGIKLAEGQHGIDQVFVATMGAGI
LNKQSGIASALVDTLNLRPAMAETVENGPASGASAIKLGYMAIASGMCDAVLVVGGEMMR
VVSGWEGTDFVATMLHPEAEYNYGITLPTLAGMFTRLCMEKYGITEKDLAIVSVKNHENA
LHNPVAHLHIVPNLYAITEDEDAGIVNPYVASPLRLYSVCPVSDGAAAVLLCAMDKADRF
AKKPVKIAGIGQATDTHAVAEREVSTDLLAVRLAAQNAYEMAGLKPEDIDVAELHDAFQI
LEIVESEEVGFFKRGEGHIAARNGETKIGGKIPINTSGGLKAKGHPLGATGVSQVVEIVK
QLRGEATGRQVKDAKAGLAVNFGGFGNNVVATILTKEAE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagtaggaattgttggtgttggtcatactaattttggtaaattttcagggggg
acttttatcgatatgatcagtatggcagctgtagaagcacttgatgacgccggcattaaa
ttagctgagggacaacacggaatagatcaagtttttgtagctacaatgggcgctggtata
ttaaataaacaaagtggtattgcatctgcacttgtagacactttgaatttaagaccagca
atggctgaaactgtagaaaatggtcctgcatccggtgcttcagcaataaaactaggttat
atggcaattgccagtggaatgtgtgatgctgttctcgtcgttggtggtgaaatgatgagg
gttgtcagtggatgggaaggcacagactttgttgccaccatgcttcatcctgaggcagaa
tacaattatggtataacgcttccaacgcttgcaggaatgtttacaagattatgtatggaa
aaatacggaattacagaaaaggatttagcaattgtatcagtcaaaaatcatgaaaatgca
ctgcataatccggtagctcatcttcatatagtaccaaatctttatgcaattactgaagat
gaagacgctggcatagttaatccttatgtggcttctccacttagattatactcagtttgt
ccagtttcagatggtgcagcagcagttttgctgtgtgctatggataaagctgatagattt
gcaaagaaaccagttaaaattgctggaattggtcaagctacagatacacatgcagtagca
gaaagagaagtatctacagatttacttgcagtaagattggcagcgcaaaatgcatacgaa
atggcaggattaaaacctgaggatattgacgtagcagaactccatgatgcatttcagata
cttgaaattgtggaatctgaagaagttggtttctttaagaggggtgaaggccacatagca
gctagaaatggtgaaacaaaaattggaggtaagattccaataaacacatcaggaggctta
aaagcaaaaggtcatccacttggtgcaacgggagtttcacaagtcgtagaaatcgtaaaa
caactgagaggggaagcaactggtcgtcaggtaaaagacgctaaggctgggctcgctgta
aatttcggtggatttggcaataatgttgtagcaacaatactcacaaaggaggcggagtaa

DBGET integrated database retrieval system