KEGG   Clostridium autoethanogenum: CAETHG_3585Help
Entry
CAETHG_3585       CDS       T02883                                 

Definition
(GenBank) 3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase III
  KO
K22839  2-acetylphloroglucinol acetyltransferase [EC:2.3.1.272]
Organism
cah  Clostridium autoethanogenum
Brite
KEGG Orthology (KO) [BR:cah00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CAETHG_3585
Enzymes [BR:cah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.272  2-acetylphloroglucinol acetyltransferase
     CAETHG_3585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGY77788
UniProt: U5S2D6
Position
3856421..3857650
Genome map
AA seq 409 aa AA seqDB search
MKEKLKRAAIVGIGTTAKPGNIHPYKTWKDLVADAAYEAIGDAKGLKPRDIDGGVIAYHG
EGVNEQGGIGGSVADLLGIAPAPVFPHSMNCSGSAVALNTGWEMIASGKYKRVLVMGFEK
EGDNINYTENINISFDTEYDYMFGFRHRDGFELMSNYYMKHYGYEDYTSYAAMSYAAHTY
GRMNPKASVYGKPMPEFESLKNANSCFSMMGEGAAAAILVPEEDAYLYTDKPVFIEGISL
ACTSHYIAHRVGEPPMGPDFPEGLKKEETYGQSVALIAAARDAYDMAGITAKDIDVAQVY
DLTAGSFWFLDGLGITKFGEGGRYFIEGKAMLDGGAVPINTDGGNIARGHASGADGLNQV
IEDVVQLRGDAGERQVKDAKVGVAACVGSAFAHMTVVVLTNDKFKRKEA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaattaaagagagcggcaattgtaggaattggtactactgcaaaaccagga
aatattcatccatataaaacgtggaaagatttagtagctgatgctgcttatgaagcaatt
ggagacgcaaaaggattaaaaccaagagatattgatggaggcgttattgcttaccatgga
gaaggagtaaatgaacaaggcggtataggaggcagtgttgctgatttacttggtattgct
ccagcacctgtatttccacattctatgaattgttcaggaagtgcagttgcattgaataca
ggatgggaaatgatcgcatctggaaaatacaaaagagttttagttatgggatttgaaaaa
gaaggagataacattaattatactgaaaatattaatataagtttcgatactgagtacgat
tatatgtttggatttagacacagagatggatttgaacttatgagtaactactatatgaaa
cattatggttacgaagattacacttcttatgcagctatgtcttatgcagcacatacttat
ggaagaatgaatccaaaagcatctgtatatggaaagccaatgcctgagtttgaatcacta
aaaaatgctaattcatgttttagtatgatgggagaaggagcagcagcagctatcttagta
ccagaggaagatgcatatctttatacagataaacctgtatttattgaaggaattagtttg
gcttgtacatcacattacatagcacatagagtaggtgagccaccaatgggaccagacttc
ccagaaggcttaaagaaagaagaaacttacggacaatctgtagcgttgattgcagcagca
cgagatgcttacgatatggctggtataacagcaaaggatattgatgtagctcaagtatac
gatttgacagcggggtcattctggttcttagatggattgggaattacaaaatttggagaa
ggcggaaggtactttatagaaggaaaagctatgctagatggtggtgctgtaccaattaat
acagatggtggtaacatcgcaagaggacatgcttctggcgcagacggattgaatcaagta
attgaagatgtagttcagttacgtggagatgcaggagaaagacaggtaaaggatgcaaaa
gtaggtgttgcagcatgtgttggtagtgcatttgcccatatgacagttgtagtattgaca
aatgataagtttaagagaaaagaagcttaa

DBGET integrated database retrieval system