KEGG   Clostridium autoethanogenum: CAETHG_3932Help
Entry
CAETHG_3932       CDS       T02883                                 

Definition
(GenBank) Xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
cah  Clostridium autoethanogenum
Pathway
cah00040  Pentose and glucuronate interconversions
cah00051  Fructose and mannose metabolism
cah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CAETHG_3932
   00051 Fructose and mannose metabolism
    CAETHG_3932
Enzymes [BR:cah01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     CAETHG_3932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AGY78133
UniProt: U5S3A4
Position
4212260..4213582
Genome map
AA seq 440 aa AA seqDB search
MKEYFNNVSKINYEGPDSKNPYSFKYYNPDEVIGGKKMRDHLRFSMSYWHTLTANGTDQF
GSGTMVRPWDNVNDKMELAKARMEAAFEFMNKLDIDYFCFHDRDIAPEGKDLAETNKNLD
EIVAMCKDLMKKNNKKLLWGTANLFNNPRFVHGAGTTCNANVYAYSAAQLKKAIEVTNEL
GGENYVFWGGREGYETLLNTDMGFEMDNFARILQMAVDYAKKIGFKGQFLIEPKPKEPTK
HQYDFDVATVLGFLRKYKLEDYFKINIEANHATLAGHTFQHEICLARNNNALGSLDANQG
DPHLGWDTDQFPTNVYDTTLSMYEVLKNGGIAPGGLNFDAKVRRASFEPEDLFLAYIAGM
DSFAKGLRVAYKLLQDAPIENFIKERYSSFSTGIGKDIVDGKVGFDELEKYALENNVINN
KSGRQEYLESVVNQYILEDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtactttaataatgtatctaaaataaattatgaaggaccggattcgaaaaat
ccttactcgtttaaatattataatcctgatgaagtaattggcggaaaaaagatgagagat
catttaagattttcaatgtcttactggcatacattaactgctaatggaactgatcagttt
ggatcaggaacaatggttaggccatgggataatgtaaacgataaaatggaacttgctaaa
gcaagaatggaagcagcatttgaatttatgaacaagctagatatagattatttttgcttt
catgatagagatatagcacctgaaggaaaagaccttgcagaaacaaataaaaatttagat
gaaatagtagcaatgtgtaaggacttaatgaaaaagaacaataaaaaattattatggggt
acggctaacttatttaataatccaagatttgtacatggtgctggaactacatgtaatgcg
aatgtttatgcttattcagcagcacagctaaaaaaagcaatagaagttacaaatgaatta
ggtggagaaaactatgtattttggggtggaagagaaggatatgaaacacttctaaatact
gacatgggatttgaaatggacaactttgctagaatactacaaatggcagtagattatgca
aagaaaataggatttaaaggacaatttcttatagaaccaaagccaaaggaacctacaaaa
catcagtatgattttgatgtagcaactgttttaggatttttaagaaagtacaagctagaa
gattacttcaagataaatattgaagcaaatcatgctactttagcaggacatactttccag
catgaaatatgcctagcaagaaataataatgcgcttggaagcttagatgcaaaccaggga
gatccacatcttggatgggatacagatcaatttcctacaaatgtatacgatacaacatta
tcaatgtacgaagtacttaaaaatggcggtatagcaccaggaggattgaactttgatgca
aaggtaagaagagcatcttttgaaccagaagatttattcttagcatatatagcaggaatg
gatagtttcgctaaaggacttagagttgcatataaattattacaagatgctcctattgaa
aactttattaaagaaagatattcaagcttttctacaggaataggtaaagacatagtagat
ggcaaagtaggatttgatgaattagaaaaatatgctttagaaaataatgttataaataat
aaatcaggaagacaagaatatttagaatcagtagtaaatcaatatatacttgaggataaa
tag

DBGET integrated database retrieval system