KEGG   Catenulispora acidiphila: Caci_0067Help
Entry
Caci_0067         CDS       T00967                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cai  Catenulispora acidiphila
Pathway
cai00010  Glycolysis / Gluconeogenesis
cai00620  Pyruvate metabolism
cai00640  Propanoate metabolism
cai00680  Methane metabolism
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01120  Microbial metabolism in diverse environments
cai01130  Biosynthesis of antibiotics
cai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caci_0067
   00620 Pyruvate metabolism
    Caci_0067
   00640 Propanoate metabolism
    Caci_0067
  Energy metabolism
   00680 Methane metabolism
    Caci_0067
Enzymes [BR:cai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Caci_0067
Lipid biosynthesis proteins [BR:cai01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Caci_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACU69022
UniProt: C7QH83
Position
complement(67729..69684)
Genome map
AA seq 651 aa AA seqDB search
MSNEALSNLLREDRRFAPSAAFAADANVKADAYAAAEADRLAFWDTQASRLSWDTPWSET
LDWSGMPVAKWFVGGKLNVAYNCVDRHVEAGNGDRVAIHFEGEPGDSRAITYAELKDEVS
KAANALTELGVRQGDRVAIYMPMIPETAVAMLACARIGAVHSVVFAAFSPDALRARIEDA
GAKLLITADGYHRRGGTVNLKANADEAVNGAETIENVLVVKRTGADVAWGDKDVWWHDAV
GGASTEHTPEAFDSENPLFILYTSGTTGKPKGILHTTGGYLTQASYTHHAVFDLKPESDV
YWCTADVGWVTGHSYIVYGPLSNGVTEVMYEGTPDTPHQGRFWEIIQKYKVSLLYTAPTA
IRMFAKWGDDIPAKFDLSSLRLLGSVGEPINPEAWIWYRKNIGGDRTPVVDTWWQTETGA
IMISPLPGVTEAKPGSAMRPLPGISANVVDKDGNIVGNGHGGLLVLDKPWPSMARGIWGD
QQRFIDTYWARFAEQGYYFAGDGAKKDEDGDLWLLGRVDDIMLVSGHNISTTEVESALVS
YPAVAEAAVVGAKDETTGQRIVAFVILRAGQEETEGLDAALKAHVSKEIGPIAKPKQIQI
VPELPKTRSGKIMRRLLKDVAEDRVVGDTTTLADSTVMDLIKAKLPHANED
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaacgaggccctttccaacctgctccgtgaggaccgccggttcgcgccgtccgcg
gccttcgccgccgacgcgaacgtcaaggccgacgcgtacgccgcggctgaggcagaccgg
ctggcgttctgggacacacaggcctcgcgcctgtcctgggacacgccctggagcgaaaca
ctggactggtcgggtatgccggtcgccaagtggttcgtcggcgggaagctgaacgtcgcc
tacaactgcgtggaccgccatgtggaggccggcaacggcgaccgcgtggccatccacttc
gagggcgagcccggcgactcccgcgccatcacctatgccgaactcaaggacgaggtctcc
aaggccgccaacgcgctgaccgagctcggtgtgcgccagggcgaccgcgtcgcgatctac
atgccgatgatcccggaaaccgctgtagcgatgctcgcctgtgcgcgcatcggtgcggtg
cactccgtggtgttcgcagcgttctcccccgacgcgctgcgcgcgcgcatcgaggacgcc
ggcgccaagctgctgatcaccgccgacggctaccaccgccgcggcggcacggtgaacctg
aaggcgaacgccgacgaggccgtgaacggcgccgagaccatcgagaacgtgctggtcgtg
aagcgcaccggcgcggacgtcgcctggggcgataaggacgtctggtggcacgacgcggtg
ggcggggcgtccaccgagcacacccctgaggccttcgacagcgagaacccgctgttcatc
ctctacacgtccgggaccacgggtaagcccaagggcatcctgcacacgaccggcggctac
ctgacgcaggcttcgtacacgcaccacgcggtgttcgacttgaagccggaatccgatgtg
tactggtgcaccgccgacgtcggttgggtcaccgggcactcctacatcgtctacgggccg
ctctccaacggcgtgaccgaggtcatgtacgagggcacccccgacaccccgcatcagggc
cgcttctgggagatcatccagaagtacaaggtcagcctcctgtacaccgcccccaccgcg
atccgcatgttcgccaagtggggcgacgacatcccggcgaagttcgacctctcctcgctg
cgcctgctgggctcggtcggcgagccgatcaaccccgaggcatggatctggtaccggaag
aacatcggcggcgaccgcactccggtggtcgacacctggtggcagaccgagaccggggcg
atcatgatctccccgctgccgggtgtcaccgaggccaagccgggctcggcgatgcggccg
ttgccgggcatctcagccaacgtcgtggacaaggacggcaacatcgtcggcaacggccac
ggcgggctgctggtcctggacaagccctggccctccatggcccgcggcatctggggcgac
cagcagcgcttcatcgacacctactgggcccgcttcgccgagcagggctactacttcgcc
ggcgacggcgccaaaaaggacgaggacggcgacctgtggctgctgggccgcgtcgacgac
atcatgctcgtctccggccacaacatctccaccaccgaagtcgaatccgccctcgtgtcc
tacccggctgtggctgaggccgcggtggtcggcgccaaggacgagaccaccggacagcgc
atcgtcgccttcgtcatcctgcgcgccggccaggaggagaccgagggcttggacgcggca
ctgaaggcgcacgtctccaaggagatcggcccgatcgccaagcccaagcagatccagatc
gtgcccgaactgcccaagacgcgctccggcaagatcatgcggcgcctgctcaaggacgtc
gccgaggaccgcgtcgtcggcgacaccaccaccctggccgactccacggtcatggatctg
atcaaggcgaagctgccgcacgccaacgaggactga

DBGET integrated database retrieval system