KEGG   Catenulispora acidiphila: Caci_0091Help
Entry
Caci_0091         CDS       T00967                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cai  Catenulispora acidiphila
Pathway
cai00010  Glycolysis / Gluconeogenesis
cai00020  Citrate cycle (TCA cycle)
cai00620  Pyruvate metabolism
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01120  Microbial metabolism in diverse environments
cai01130  Biosynthesis of antibiotics
cai01200  Carbon metabolism
Module
cai_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caci_0091
   00020 Citrate cycle (TCA cycle)
    Caci_0091
   00620 Pyruvate metabolism
    Caci_0091
Enzymes [BR:cai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Caci_0091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACU69046
UniProt: C7QHA7
Position
complement(94534..96027)
Genome map
AA seq 497 aa AA seqDB search
MGEIKRFNLPDVGEGLTEAEILAWSVKVGDLVKVNQVLVEIETAKAAVELPSPWAGKIVE
LLVDEGQTVDVGTPIIGIDTDPSTPSTGGAGGDDMTAGVAATAEAKAAPAAAKEPKEAKR
EPVLVGYGVKQGASSRRPRKTAAAPSAADVMGATVREEPVADEVPAPAYYGQSAAREAAA
PAVQTRTPDTTAAPAAPTGAKPLAKPPVRKLAKDLGVDLALVVATGTNGTVTREDVHAAA
SGTSTAAAAPAAANGTAPAAAPFVNGERRVPIKGVRKATATAMVQSAFTAPHVTEFLTVD
VTPTMKFVQRLKEMPDFKGVRVSPLLLVAKAFLVAMARNPEINARWDEAAGEIVYFDHVT
LGIAAATPRGLLVPNVKGADLLPLVELGRALNKLTDVAREGKTSLADMTGATATITNVGV
FGVDTGTPILNPGEASILAFGAVREQPWMHKGKVKPRQVTTLALSFDHRLVDGELGSKVL
RDIGAVLADPLTALAWS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagatcaagagattcaacctcccggacgtcggcgaaggcctgaccgaggccgag
atcctggcctggtcggtgaaggtcggcgacctggtcaaggtcaaccaggtcctggtcgag
atcgagaccgcgaaggcggccgtcgagctgccctcgccgtgggccggcaagatcgtcgag
ctgctggtggacgaggggcagacggtcgacgtcggcaccccgatcatcgggatcgacacc
gacccgagcacgccgagcaccggcggcgcgggcggggacgacatgaccgccggcgtcgcg
gccaccgccgaggcgaaggccgcgccggccgccgccaaggagcccaaggaagccaagcgc
gagccggtcctggtcggctacggcgtgaagcagggcgcctccagccgccgtccgcgcaag
acggcggcggcgccgtcggcagccgacgtcatgggtgccacggtccgcgaggagccagtc
gccgacgaggtcccggctccggcctactacggccagtccgcggcgcgggaggcggccgct
ccggcggtccagacccgcacgccggacaccacggccgcaccggccgcaccgaccggcgcg
aagccgctggccaagccgccggtccgcaagctggccaaggacctcggcgtcgatctggca
ctggtggtcgcgaccggtaccaacggcacggtgacccgggaggacgtccacgcggcggcc
tccgggacgtcgaccgccgctgcggcgccggctgccgccaacggcactgccccggccgcc
gcgcccttcgtcaacggcgagcgccgcgtcccgatcaagggcgtgcgcaaggcgaccgcc
acggcgatggtgcagtcggcgttcaccgcgccgcacgtcaccgagttcctgacggtcgac
gtcaccccgaccatgaagttcgtgcagcgcctcaaggagatgccggacttcaagggcgtg
cgggtgtcgccgctgctgctggtcgccaaggcgttcctggtggcgatggcgcggaacccg
gagatcaacgcgcgctgggacgaggcggccggcgagatcgtctacttcgaccacgtcacc
ttgggcatcgcggcggccacgccgcgcgggctgctggtgccgaacgtcaagggcgccgac
ctgctgccgctggtggagctgggccgcgcgctcaacaagctcaccgacgtggcacgcgag
ggcaagacctcgctggcggacatgaccggcgccacggcgacgatcaccaacgtcggcgtc
ttcggtgtggacaccggcaccccgatcctcaaccccggcgaggcgtcgatcctggcgttc
ggcgcggtgcgggaacagccgtggatgcacaagggcaaggtgaagccgcgccaggtgacc
acgctcgcgctgtccttcgaccaccgcctggtcgacggcgagctgggttcgaaggtgctg
cgggacatcggtgcggtcctcgcggacccgctgaccgcgctcgcctggagctga

DBGET integrated database retrieval system