KEGG   Catenulispora acidiphila: Caci_0936Help
Entry
Caci_0936         CDS       T00967                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cai  Catenulispora acidiphila
Pathway
cai03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cai00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Caci_0936
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cai03011]
    Caci_0936
Ribosome [BR:cai03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Caci_0936
  Bacteria
    Caci_0936
  Archaea
    Caci_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACU69868
UniProt: C7Q2M6
Position
1084825..1085217
Genome map
AA seq 130 aa AA seqDB search
MAENKAKDLAGNEAIAQAKNIRMTAMKVRRVVDMVRGQDVEQALDTLRFAPYAAAEPVFK
CVASAAANARNNKQLRGSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITIVVQET
AGVAQKGRTR
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagaacaaggccaaggacctcgcgggcaatgaggctattgcccaggcgaagaac
atccgcatgaccgccatgaaggtgcgccgggtcgtggacatggtccgcggccaggacgtc
gagcaggcgctcgacaccctgcgcttcgcgccgtacgccgccgcagagccggtcttcaag
tgcgtcgcgtcggctgcggccaacgcgcgcaacaacaagcagctccgcggctcgctggtc
atcagcgaggcctatgtggacgagggtccgaccctgaagcggttccggccgcgtgctcag
ggccgtgcctaccgcatccgcaagcggacttcgcacatcacgatcgtggtccaggagacc
gcgggcgtcgcgcagaagggcaggacccgatag

DBGET integrated database retrieval system