KEGG   Catenulispora acidiphila: Caci_2547Help
Entry
Caci_2547         CDS       T00967                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cai  Catenulispora acidiphila
Pathway
cai00040  Pentose and glucuronate interconversions
cai00052  Galactose metabolism
cai00500  Starch and sucrose metabolism
cai00520  Amino sugar and nucleotide sugar metabolism
cai01100  Metabolic pathways
cai01130  Biosynthesis of antibiotics
Module
cai_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Caci_2547
   00052 Galactose metabolism
    Caci_2547
   00500 Starch and sucrose metabolism
    Caci_2547
   00520 Amino sugar and nucleotide sugar metabolism
    Caci_2547
Enzymes [BR:cai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Caci_2547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACU71465
UniProt: C7PXL2
Position
complement(2881293..2882234)
Genome map
AA seq 313 aa AA seqDB search
MAETIRRAVIPAAGIGSRMLPLTKAIPKEMLPVGDRPVIEHTVRELVASGITDITIVVSG
GKSLIQDHFRPNPALVEQLRAAGKDDYAQAVEDVAELARAGHITYQDQHGPYGNGTPVLN
AARGLGSTEPMLVLWPDDVFVAEVPRAQQLIAAYEATGCPMLALMPMDRSQSQRYGVPIV
HEDLGEGLLRISGLLEKPKPADAPSDFAAIGGYVVTPGIVEELHEATVRWSRQRTGEVYL
TDAINAYAETRAVYGQVIAGHWYDTGNPADYLVAQFAHALADPEYGPVLRSLAAGIDAGL
DSGNGGGGGASGS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagacgatccgcagggcggtgatcccggcggccgggatcggttcgcgcatgctc
cctttgaccaaggcgatccccaaggagatgctgccggtcggcgaccggccggtgatcgag
cacacggtgcgcgagctggtggcctccggcatcaccgacatcaccatcgtcgtctccggc
ggcaagtcgctgatccaggaccacttccgtccgaacccggcgctcgtggagcagctgcgc
gccgcgggcaaggacgactacgcccaagccgtcgaggacgtcgccgagctggcgcgcgcc
ggccacatcacctaccaggaccagcacggcccgtacggcaacggcaccccggtgctgaac
gccgcgcgcggtctgggcagcaccgagccgatgctcgtgctgtggcccgacgacgtgttc
gtggccgaggtcccgcgcgcgcagcagctcatcgccgcctatgaggcgaccggctgtccg
atgctggcgctgatgccgatggaccgctcgcagtcgcagcgctacggcgtcccgatcgtc
cacgaggacctcggcgagggcttgctgcggatctcgggcctgttggagaagcccaagccc
gcggacgcgccgagcgacttcgccgcgatcggcggctacgtcgtcacccccgggatcgtg
gaggagctgcacgaggcgaccgtgcgctggtcgcggcagcgcaccggcgaggtgtacctc
accgacgcgatcaacgcctacgccgagacccgcgcggtgtacgggcaggtcatcgcaggg
cactggtatgacaccggcaacccggcggactacctggtcgcgcagttcgcgcacgccttg
gccgatcccgagtacggaccggtgctgcgatcgctcgccgccggcatcgacgccggtctc
gacagcggaaacggtggcggtggcggcgcctcgggcagctga

DBGET integrated database retrieval system