KEGG   Catenulispora acidiphila: Caci_3363Help
Entry
Caci_3363         CDS       T00967                                 

Definition
(GenBank) acyl-CoA oxidase domain protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
cai  Catenulispora acidiphila
Pathway
cai00071  Fatty acid degradation
cai00592  alpha-Linolenic acid metabolism
cai01040  Biosynthesis of unsaturated fatty acids
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01212  Fatty acid metabolism
Module
cai_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Caci_3363
   00592 alpha-Linolenic acid metabolism
    Caci_3363
   01040 Biosynthesis of unsaturated fatty acids
    Caci_3363
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     Caci_3363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 PAS_3
Motif
Other DBs
NCBI-ProteinID: ACU72270
UniProt: C7Q7S7
Position
3713287..3715173
Genome map
AA seq 628 aa AA seqDB search
MPPVPAAVDPDTLTSLLDGRWAGLRADIRAEMAAAPYRDPIDLSVEEHRSRVFDQLTALA
ANDRAGLGFDKAYGGGSDIGGSVVSFEMLGFGDLSLMVKAGVQWGLFGGAVQLLGTAPHH
ERYLRRIRDLDLLGCFAMTEHGHGSDVQHLRTTATYDPDSGEFVVHTPDRGATKEYIGNA
ARDGRVAVVFAQLTTQGETRGVHAFVVPIRDDAGAPAPGVTIEDCGPKAGLNGVDNGRLS
FDQVRIPREALLNRFGDVAPDGTYSSPIEGDARRFFTMLGTLIRGRVSVGGSAGSATKRA
LALAVRYAELRRQFATPDGEEVVILDYLGHQRKLLPALATSYALHFAQEELVAALHDITD
DAPEQEQRELESRAAGLKVANTWHATAAIQAAREACGGAGYLAENLLPGLKADTDVFTTF
EGDNTVLLQLVAKGLLTEYKDAFQNLSPLATVRFAAERVLGAVAERTSARKVVDRLTDGD
DREALFDRDWQLKLFEDREQHVLGGVADRLRKAAQDPFGVFNAAQDHVLRAGRVHVDRLV
LEAFVRAIARCTDPDAKALLERVCDLYALANIEADRAWFLEHGRLSTGRSKAVIAAVNTL
CGELRPHARTLVDAFAIPEQYLAAPMLS
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgtgcccgccgcggtcgatccggacaccctgacctcgctgctggacggccgc
tgggccggcctgcgcgccgacattcgcgcggagatggccgccgcgccctaccgcgatccg
atcgacctcagcgtggaagagcaccgcagccgggtcttcgaccagctgacggcgctcgcc
gcgaacgaccgcgcgggcctgggcttcgacaaggcctacggcggcgggagcgacatcggc
ggctcggtggtctccttcgagatgctcggcttcggcgacctgtcgctgatggtcaaggcc
ggcgtgcagtggggtcttttcggcggcgcggtgcagctgctgggcaccgcgccgcaccat
gagcgctacctgcgccgcatcagggacttggacctgctcggctgcttcgcgatgaccgag
cacggtcacggctcggacgtccagcacctgcggaccaccgcgacctacgacccggacagc
ggcgagttcgtcgtgcacaccccggaccgcggcgccaccaaggagtacatcggcaacgcc
gcgcgcgacggacgcgtggcggtggtgttcgcacagctcaccacgcagggcgagacgcgc
ggcgtgcacgccttcgtcgtcccgatccgcgacgacgccggagcgccggcgcccggcgtc
accatcgaggactgcggtcccaaagccggcctcaacggcgtcgacaacggccgcctgagc
ttcgaccaggtccgcatcccgcgcgaagcgctgctcaaccgcttcggcgatgtcgcgccg
gacggtacctactccagcccgatcgagggtgacgcgcgccgcttcttcaccatgctcggc
accctgatccgcggccgggtcagcgtcggcgggagcgccggaagcgcgaccaagcgggca
ctggcgctcgccgtccgctacgccgagctgcgtcggcagttcgccacgccggacggcgag
gaggtggtgatcctggattacctgggtcaccagcgcaaactgctgcccgcgctggccacc
agctacgcgctgcacttcgcgcaggaagaactcgtcgccgcgctccacgacatcaccgac
gacgcccccgagcaggagcagcgcgagctggaatcccgcgccgccggtctcaaggtcgcc
aacacctggcacgccaccgccgcgatccaggcggcgcgcgaagcctgcggcggcgccggc
tacctcgccgagaacctgctgcccgggctgaaggccgacaccgacgtcttcaccaccttc
gagggcgacaacaccgtcctgctgcagctcgtcgcgaagggtctgctgaccgagtacaag
gacgccttccagaacctgagcccgctggcgacggtgcggttcgccgccgaacgcgtcctg
ggcgcggtcgccgagcggacgtcggcgcgcaaggtcgtggaccggctgaccgacggcgac
gaccgcgaggcactgttcgaccgcgactggcagctcaagctgttcgaggaccgcgagcag
cacgttctgggaggcgtcgccgaccggctgcgcaaggccgcgcaggatcctttcggggtg
ttcaacgccgctcaggatcatgttctgcgcgcggggcgcgtgcatgtcgatcgactggtg
ctggaggccttcgttcgcgcgatcgcgcgttgcacggaccctgatgcgaaggcgttgctg
gagcgggtctgcgacctctacgcgctggcgaacatcgaggcggaccgtgcctggttcctg
gagcacggacggctgagcaccgggcggtcgaaggcggtcatcgcggcggtgaacacgctg
tgcggcgagctacgtccgcacgcgcggacgctcgtggacgccttcgctattccggagcag
tacctggccgctccgatgctgagctga

DBGET integrated database retrieval system