KEGG   Catenulispora acidiphila: Caci_5471Help
Entry
Caci_5471         CDS       T00967                                 

Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
cai  Catenulispora acidiphila
Pathway
cai00220  Arginine biosynthesis
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01130  Biosynthesis of antibiotics
cai01210  2-Oxocarboxylic acid metabolism
cai01230  Biosynthesis of amino acids
Module
cai_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Caci_5471
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     Caci_5471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ACU74330
UniProt: C7Q9I4
Position
complement(6309014..6310048)
Genome map
AA seq 344 aa AA seqDB search
MHMTYTAAVAGATGYAGGELLRLLLGHPDFQIGALTAGTSAGTRLGEHQPHLAPLADRVV
ADTTPETLAGHDVVFLALPHGQSAAIAEALGPDTLIVDCGADYRLADAGVWEKFYGSPHA
GTWPYGLPELPGARAALTGAKRVAVPGCFPTVSTLALAPAVGAGLVEPDVVVVAATGTSG
AGKSLKPNLLGSEIMGNVAAYNIGGVHRHSPEIAQNLGAVAGQAVTVSFTPLLVPMPRGI
LATCTAKVKPGVGEEQLRDAYLKAYGDEPFVTVLPQGQLPTTAAVLGANTVQIQVAFDEA
AGRAVVVGAIDNLTKGTAGGALQCANLALGLPEPAGLSTVGIAP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgacctacacggcggcggtggccggagccaccggctacgcgggcggcgagctg
ctgcggctcctgctcgggcatccagacttccaaataggcgcgctcaccgcggggacgagc
gccgggacccgattgggcgagcaccagccgcatctggcgccgctggccgaccgcgtggtc
gccgacaccacgccggagacgctggccgggcacgacgtcgtcttcctcgccctgccgcac
ggacagtccgccgcgatcgccgaagcgctgggaccggacaccctgatcgtcgactgcggc
gccgactaccgcctcgccgacgccggggtctgggagaagttctacggctccccgcacgcc
gggacctggccctacggcctgcccgagctgcccggcgcgcgcgccgcgctcaccggcgcc
aagcgggtcgccgtccccggatgcttcccgaccgtctccacgctcgcgctcgccccggcc
gtcggcgccgggctggtcgagccagacgtggtcgtggtcgccgcgaccgggacctccggc
gccggcaagtccctgaagccgaacctgctcggctcggagatcatgggcaacgtcgccgcg
tacaacatcggcggcgtccaccggcacagcccggagatcgcgcagaacctcggcgcggtc
gcgggacaagcggtgaccgtgtccttcacgccgctgctggtccccatgccgcgcgggatc
ctcgccacctgcaccgcgaaggtgaagccgggcgtcggcgaagagcagctgcgggacgcc
tatctgaaggcgtacggcgacgagccgttcgtgaccgtcctgccgcaggggcagctgccc
acgacggccgcggtcctcggagcgaacaccgtgcagatccaggtcgcgttcgacgaggcg
gccgggcgcgccgtcgtcgtcggcgcgatcgacaacctcaccaagggcaccgccggcggc
gccctgcagtgcgccaacctcgcgctcggcctgccggagcccgccggtctgagcaccgtc
gggatcgcgccgtga

DBGET integrated database retrieval system