KEGG   Catenulispora acidiphila: Caci_6186Help
Entry
Caci_6186         CDS       T00967                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cai  Catenulispora acidiphila
Pathway
cai00071  Fatty acid degradation
cai00280  Valine, leucine and isoleucine degradation
cai00281  Geraniol degradation
cai00310  Lysine degradation
cai00360  Phenylalanine metabolism
cai00362  Benzoate degradation
cai00380  Tryptophan metabolism
cai00410  beta-Alanine metabolism
cai00627  Aminobenzoate degradation
cai00640  Propanoate metabolism
cai00650  Butanoate metabolism
cai00903  Limonene and pinene degradation
cai00930  Caprolactam degradation
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01120  Microbial metabolism in diverse environments
cai01130  Biosynthesis of antibiotics
cai01212  Fatty acid metabolism
Module
cai_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Caci_6186
   00650 Butanoate metabolism
    Caci_6186
  Lipid metabolism
   00071 Fatty acid degradation
    Caci_6186
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Caci_6186
   00310 Lysine degradation
    Caci_6186
   00360 Phenylalanine metabolism
    Caci_6186
   00380 Tryptophan metabolism
    Caci_6186
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Caci_6186
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Caci_6186
   00281 Geraniol degradation
    Caci_6186
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Caci_6186
   00627 Aminobenzoate degradation
    Caci_6186
   00930 Caprolactam degradation
    Caci_6186
Enzymes [BR:cai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Caci_6186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACU75040
UniProt: C7QIG3
Position
7120250..7121038
Genome map
AA seq 262 aa AA seqDB search
MNAELPAVRTEKNGAVTTVILHRPAVRNAVDPATAAGLVAAFREFEEDAGANVAVFFGDG
GTFCAGFDLKALTAGAVPAGMLAYGDGPMGPSRLRLSKPVIAAVAGHAVAGGLELALWCD
LRVVEESAVFGVFCRRWGVPLVDGGTVRLPRLIGHSRAMDMILTGRAVAADEALAWGLAN
RVVPDGTVRAAAEALAAEIAALPQLCLREDRMSVLEQDGLDEEAALRNELRHGQVSLSES
AAGAQRFAGGEGRHGASASPTP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgagctccctgccgtccgcaccgagaagaacggtgcggtcacgaccgtgatc
ctgcatcggcctgcggtgcgcaatgcggtggatccggcgacggcggcggggttggtggct
gcgtttcgggagttcgaggaggatgccggggctaatgtcgcggtgttctttggcgatggg
gggacgttctgtgccgggttcgatctcaaggctctgactgctggggcggtgccggcgggg
atgctggcttacggggacgggccgatgggtccttcgcggttgcggctgtccaagccggtg
attgcggcggtcgccgggcatgcggtggccggtgggctggagttggcgctgtggtgtgac
ctgcgggtggtggaggagagcgcggtgttcggcgtcttctgtcggcgctggggtgttccg
ttggtggatggtgggacggtgcggctgccgcgtctgatcgggcacagtcgcgccatggac
atgatcctcaccgggcgcgcggtcgccgctgacgaggctctggcctgggggttggccaac
cgggtggtgcccgatggcacggtccgcgccgccgctgaggcgctggccgcggagatcgcc
gcgctgccgcagctgtgcctgcgcgaagatcgcatgtcagtactcgagcaggacggtctg
gacgaggaggccgcgctgcgcaacgagctgcggcacgggcaggtctcgctgtccgagtcg
gccgccggcgcgcagcggttcgccggcggcgagggacgccacggcgcctcggcgagcccg
acgccgtag

DBGET integrated database retrieval system