KEGG   Catenulispora acidiphila: Caci_6489
Entry
Caci_6489         CDS       T00967                                 

Definition
(GenBank) ccyl-CoA dehydrogenase type 2 domain protein
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
cai  Catenulispora acidiphila
Pathway
cai01057  Biosynthesis of type II polyketide products
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cai00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    Caci_6489
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:cai01008]
    Caci_6489
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     Caci_6489
Polyketide biosynthesis proteins [BR:cai01008]
 Polyketide tailoring proteins
  Oxygenase
   Caci_6489
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Other DBs
NCBI-ProteinID: ACU75339
UniProt: C7PWQ9
Position
7480102..7481265
AA seq 387 aa
MVTHPPQSPPPRPSDPARLPAAAEKVAVLAAEHSAETEAARDLAPEVVAAVVEAGFARFY
VPSRFGGGVAPDAAPDYRGLVEAVAAVGLGCASTAWFASLTASLGRMAAFLADSAQEAVW
GDGPDPVVVGALMPAGKAAREGDGWRLSGAWPYVSGVTSSDWALLCAMAEGDEGAKPHAR
FFAVPRSAYTITESWFSVGMRGTGSNTVTVRDVRVAADFTVTREALLAGQGPDAAPAYRA
PLRSINGLTFAAPLLGAARAALNAHTASLAAKPAPLADDAAALIGRVDGEIEAAAALLDR
VASAAERGEHSPDEVARATRDCALAAELLPAAIDRLVRASGTSAMAETSALQRFWRDLNV
GSSHIVLKQHPAAAAYGAALVKKAGAR
NT seq 1164 nt   +upstreamnt  +downstreamnt
gtggtcacccatcctccgcaatcaccgccgccccggccgtccgatccagctcgcctgccg
gcagcggccgagaaggtcgcggtcttggccgctgagcattccgccgagaccgaagcggct
cgggacctggcgccggaggtggtcgcggcggtcgtcgaggccggcttcgcgcgcttctac
gttccctcgcgtttcgggggcggcgtcgcgccggacgccgcgccggactatcgcggcctg
gtcgaggccgtcgccgcggtcggtctcggatgtgcctccaccgcgtggttcgcttcgctc
accgcgagtctggggcggatggccgcgttcctggcggattccgcgcaggaggcggtgtgg
ggtgacgggccggatccggtcgtcgtcggggcgctgatgcctgctgggaaggctgctcgc
gagggtgacgggtggcggctcagtggtgcctggccttatgtcagtggtgtgacgtcctcg
gactgggctctgctgtgcgcgatggccgagggtgatgagggggcgaagccgcacgcgcgg
ttcttcgctgtcccgcgctcggcttacacgatcaccgagagctggttcagcgtcgggatg
cggggaaccgggagcaacacggtcacggttcgggacgtgcgtgtcgccgctgacttcacc
gtcacccgcgaggcgctgctcgccgggcagggaccggacgcggcgccggcctatcgggct
ccgctgcgctccatcaatggtctgacattcgcggcgccgctgctgggtgccgcgcgcgcc
gcgctgaacgcgcacaccgcctcgctggccgccaagcccgcgccgctcgccgacgacgcc
gccgcgctgatcggccgggtcgacggtgagatcgaggccgccgcggcgttgctggaccgg
gtggcttcggctgccgagcgcggcgagcactcccccgacgaggtcgcgcgcgccacccgg
gactgcgcgctggccgccgagctgctgccggccgcgatcgaccggctggtacgcgcctcg
ggcacctcggcgatggccgagacctcggcgctgcaacggttctggcgcgacctcaacgtc
ggctccagccacatcgtgctgaagcagcatcccgcggccgcggcctacggcgcggccctc
gtgaagaaggcaggtgcgcggtga

DBGET integrated database retrieval system