KEGG   Catenulispora acidiphila: Caci_7256Help
Entry
Caci_7256         CDS       T00967                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
cai  Catenulispora acidiphila
Brite
KEGG Orthology (KO) [BR:cai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Caci_7256
Enzymes [BR:cai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     Caci_7256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DLP_helical
Motif
Other DBs
NCBI-ProteinID: ACU76085
UniProt: C7Q897
Position
complement(8431412..8432068)
Genome map
AA seq 218 aa AA seqDB search
MDRAAHVHGARQVVLWRHGRTAWNLERRFQGQTDIPLDDVGLAQAERAARVLAGLGPSVI
VASDLIRATRTAETLARLTNLPVTLDEALRETYAGRWQGLNDDEIVARYPEEFEAFRRGE
PIRRGGGELEVEVAERVVPAILRALEKVPPAGTLVVATHGGAARVALGRMMGLPYELWGA
LGGLSNCCWSILGEARRGWRLLEHNAGTLLEPVIGDDE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgccgcgcacgtacacggcgcacgccaagtcgtcctgtggcgccacggccgc
accgcctggaacctggagcgccgcttccaaggccagaccgacatcccgctggacgacgtc
ggcctggcccaagccgaacgcgccgcccgcgtcctggcgggcctcggtcccagcgtcatc
gtcgcctccgacctgatccgcgccacccgcaccgccgaaaccctcgcccgcctcaccaac
ctcccggtcaccctcgacgaagccctccgcgaaacctacgcaggccgctggcaaggcctc
aacgacgacgaaatcgtcgcccgctacccggaggaattcgaagccttccgccgaggcgaa
cccatccgccgaggcggcggcgaactagaagtcgaagtagccgaacgcgtagtccccgcc
atcctccgagccctggaaaaggtccccccggccggcaccctggtagtagccacccacggc
ggagccgcccgcgtagccctcggccgcatgatgggcctcccctacgaactctggggcgcc
ctaggcggcctctccaactgctgctggtccatcctcggcgaagcccgccgcggctggcgc
ctcctggaacacaacgccggcacacttctggagccggtcatcggagacgacgagtag

DBGET integrated database retrieval system