KEGG   Catenulispora acidiphila: Caci_7656Help
Entry
Caci_7656         CDS       T00967                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
cai  Catenulispora acidiphila
Pathway
cai00220  Arginine biosynthesis
cai00250  Alanine, aspartate and glutamate metabolism
cai00471  D-Glutamine and D-glutamate metabolism
cai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Caci_7656
   00220 Arginine biosynthesis
    Caci_7656
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Caci_7656
Enzymes [BR:cai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Caci_7656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase DUF3562
Motif
Other DBs
NCBI-ProteinID: ACU76480
UniProt: C7QCL7
Position
complement(8882949..8883899)
Genome map
AA seq 316 aa AA seqDB search
MANEEGAAVSVDDIAYDALLEWIADEVAPYVGDGRVADYIPALAQVPPDRFGMALATVDG
HLYGVGDFRERFSLQSISKVFTLALVMAGDAGALRGRVGVEPSGNAFNSLIQLEYERGIP
RNPFINAGALVVTDILQSQTGDAAGTVLDFLRTESDDHTITIDGAVAASEAEHGDLNLAL
AHFMAAYGNIENPVDLTAEHYFRHCSIAMSCAETAMAALFLARHGVRTGGTRLLPVLGAK
RVNALMMTCGAYDAAGDFAFRVGLPGKSGVGGGILAVVPGRAALCVWSPALDPHGNSVAG
VEALDRFSAATGWSVF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaggagggcgcggcggtctcggtggacgacatcgcctacgacgcgctgctg
gagtggatcgccgacgaggtcgccccctatgtcggcgatggccgggtcgcggactacatc
ccggcgctggcccaagtccctccggaccgcttcggcatggccttggccacggtcgacggc
catctgtacggagtcggcgacttccgcgagcgcttctccctgcagagcatctcgaaggtg
ttcaccctggcgctggtgatggccggcgacgccggggcgctgcgcggccgggtcggcgtg
gaaccctccggcaacgccttcaactccctgatccagctggagtacgagcgcggcatcccc
cgcaaccccttcatcaacgccggcgccctggtcgtcaccgacatcctgcagagccagacc
ggcgacgcggccggcacggtcctggacttcctgcgcaccgagtccgacgaccacaccatc
accatcgacggcgcggtcgccgcctccgaggccgagcacggcgacctgaacctggccctc
gcgcacttcatggccgcctacggcaacatcgagaaccccgtcgacctcaccgccgagcac
tacttccggcactgctcgatcgcgatgagctgcgccgagaccgcgatggcggcgctgttc
ctggcccgccacggcgtccgcactggcggcacccggctgctgcccgtcctcggcgccaag
cgggtcaatgccctgatgatgacgtgcggcgcgtacgacgccgcgggcgacttcgccttc
cgcgtcggcctgcccggcaagagcggcgtcggcggcgggatcctggcggtggtgccgggg
cgcgcggcgctgtgcgtgtggtcgccggcgctggacccgcacgggaactcggtcgccggc
gtggaggccttggaccgcttcagcgcggccacgggctggtcggtgttctag

DBGET integrated database retrieval system