KEGG   Catenulispora acidiphila: Caci_7916Help
Entry
Caci_7916         CDS       T00967                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cai  Catenulispora acidiphila
Pathway
cai00072  Synthesis and degradation of ketone bodies
cai00650  Butanoate metabolism
cai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Caci_7916
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Caci_7916
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Caci_7916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR 2-Hacid_dh_C NAD_binding_10 AdoHcyase_NAD 3HCDH_N ADH_zinc_N NAD_binding_7 Shikimate_DH Methyltransf_11 3Beta_HSD Polysacc_synt_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACU76739
UniProt: C7QFG2
Position
complement(9188325..9189107)
Genome map
AA seq 260 aa AA seqDB search
MDAAVTSVAALDLSGRTALVTGAAGGIGLACAERLAAAGAKVVVADISADGAHAAAEKVG
GEALVADLSDLDQASALPHRIGGVDVLVNNAGLQHVAPLHEFPVDRFSLILRLMLEAPFR
LIRESLPHMYERGWGRVVNISSAHGLRASEFKAAYVTAKHGLEGLSKVAALEGAPYGVTS
NCVNPAYVRTPLVENQIADQAAAHGIPPEEVVAKVMLERSAVKRLIEPAEVAELVAYLCS
PAAASVSGASLAMDGGWTAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgctgtcacttctgtcgccgccctggacctgtccggccgcaccgcgctggtc
accggtgccgccggcggcatcgggctggcctgcgccgagcggctggccgcggccggcgcc
aaggtggtcgtcgccgacatcagcgccgacggcgcgcacgccgccgccgagaaggtcggc
ggcgaggcgctggtcgccgacctgagcgacctggaccaggcctcggcactgccgcaccgg
atcggcggggtggacgtgctggtcaacaatgccggcctgcagcacgtcgcgccgctccac
gagttcccggtcgaccgcttctcgctgatcctgcggctgatgctggaggcgccgttccgc
ctgatccgcgagtcgctgccgcacatgtacgagcgcggctgggggcgggtcgtgaacatc
tcctcggcgcatgggctgcgcgcctcggagttcaaggccgcgtacgtgacggccaagcac
ggcctggaagggctgtcaaaggtcgcggcgctggagggcgcgccgtacggcgtcacctcg
aactgcgtgaacccggcctacgtgcgcacgcccctggtcgagaaccagatcgccgaccag
gccgccgcgcacggcatcccgccggaggaggtggtggcgaaggtgatgctggagcgctcg
gccgtcaagcgcctgatcgagcccgccgaggtggccgagctggtggcgtatctgtgctcc
ccggccgccgcctcggtctccggcgcctcgctggccatggacggcggatggacagcacgg
tga

DBGET integrated database retrieval system