KEGG   Catenulispora acidiphila: Caci_8037Help
Entry
Caci_8037         CDS       T00967                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
cai  Catenulispora acidiphila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: ACU76860
UniProt: C7QH10
Position
9329687..9331078
Genome map
AA seq 463 aa AA seqDB search
MALIDEAAPKTAGSTPPTPGKPQRSAAFRTRAAFAGIVAGNFMVLLDATILNVALPDMKA
HLHASAAALPWTVDAYTVVFAGLMLASGAVADRFGARRVYQSAVALFGLLSLLCALAPNV
GGLIAGRALLGAAAAGMVPASLSLLAGLYPDAKDRMKAVGAWAALSGIGLAVGPVLGGAL
VAAGGWRLVFVVNPPLALVSWFLVRGLSSQASGHRKKFDIPGLVLFTVALCALTYGLVDA
GTEGWSTPSALVALAVAVLAAVAVAFVERRAETPVLPPELLRLGRVRTNLVTAVAANYIF
YGLLYSVTLWFEETRHMSAAMTGVAFLPMMVPLCFLPFFTSRLAHRFGARPMVMVAMVVN
VGVGAVLFTVGAHTSLAVVTVAQVLMAIATTLTIPSITADMAVATPRPLAATGQGALNAA
RQTGSALGVAILGTMSGMHAAGIAMAAGALLTLVLAGLTRRSA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcactgatcgacgaagccgcaccgaagaccgccggctccactcccccgacccctggc
aagcctcagcgctctgccgccttccggaccagggcggcgttcgccggcatcgtggccggc
aacttcatggtcctgctcgacgcgacgatcctcaacgtcgcgctccccgatatgaaggcg
catctgcacgcctcggccgccgcgctgccgtggaccgtggacgcctacaccgtcgtgttc
gccggcctgatgctcgcctccggcgcggtcgccgaccggttcggcgcccgccgcgtgtat
cagagcgcggtcgctttgttcgggctgttgtccctgctctgcgcgctggcgccgaacgtc
ggcggcctgatcgccggccgcgcgctgctcggcgcggcggcggccggcatggtcccggcc
tccctgtccctgctcgccgggctctaccccgacgccaaggaccggatgaaggcggtcggc
gcgtgggccgcgctgtccgggatcgggctggccgtcgggccggtgctcggcggcgcgctg
gtcgcggccggcggctggcggctggtcttcgtggtgaacccgccgctggcgctggtctcg
tggttcctggtccgcgggctgtcctcgcaggcttccggacaccgcaagaagttcgacatc
ccgggcctggtgctgttcaccgtcgcgctgtgcgcgctgacctacggtctggtggacgcc
gggaccgagggctggagcacgccgtccgcgctggtcgcgctggcggtcgcggtgctcgcg
gcggtcgccgtggccttcgtcgagcgccgggccgagaccccggtcctgccgccggagctg
ctgcgtctgggtcgggtccgcaccaacctggtgaccgcggtcgccgcgaactacatcttc
tatgggctgctgtactcggtcacgctgtggttcgaggagacgcggcacatgagcgcggcg
atgaccggcgtcgccttcctgccgatgatggtgccgctgtgcttcctgcccttcttcacc
agccggctggcgcaccggttcggcgcgcgcccgatggtgatggtggcgatggtggtgaac
gtcggggtcggcgcggtcctgttcaccgtcggcgcccacacctcgctggcggtggtgacg
gtcgcgcaggtcctgatggcgatcgcgaccacgctgacgatcccgtcgatcaccgcggac
atggcggtggccaccccgcgtccgctcgccgcgaccggccagggcgcgctgaacgccgca
cgccagaccgggagcgcgctgggcgtggcgatcctcggcacgatgtcggggatgcacgcc
gccgggatcgcgatggccgccggcgcgctgctcacgctggtgctcgccgggctcacgcgc
cgcagcgcctga

DBGET integrated database retrieval system