KEGG   Catenulispora acidiphila: Caci_8299Help
Entry
Caci_8299         CDS       T00967                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cai  Catenulispora acidiphila
Pathway
cai00220  Arginine biosynthesis
cai00330  Arginine and proline metabolism
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01130  Biosynthesis of antibiotics
cai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Caci_8299
   00330 Arginine and proline metabolism
    Caci_8299
Enzymes [BR:cai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Caci_8299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACU77122
UniProt: C7QKM3
Position
9616713..9617642
Genome map
AA seq 309 aa AA seqDB search
MIALLAAPTNLGLRPPHPSSVPGTAKAPEAFRETGLFARFTDAGARDAGVVLPGRYADDA
TPGRLRNQDAIVEHARRLARRVAEIRAAGDVPLVFGGDCSLVVGVGLALRPAGRFALVHL
DGHTDFRNPGNSDACAALAGEDLAAAIGRHWPAIADVDGLGPYFDPADTVHAGCRDDDQE
LAEVEEAISLTIPASAIIRDGAAATADRVRERVERADLDGYWLHLDVDILDATVMPAVDS
PDPGGLLPDQLTELLAALAPGAAGAHVAVFDPDLDPDGRHARLLTDIVTDGLGQLGTELK
PAAAHNAER
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgctgctggctgccccgaccaacctcgggctccgtcccccgcacccgtcgagc
gtccccggtaccgccaaggcgccggaagccttccgcgagacgggattgttcgcgcggttc
accgacgcgggcgcccgcgacgcaggcgtggtccttcccggccgctacgccgacgacgcg
acaccgggacgcctgcggaatcaggacgcgatcgtcgagcacgcacggcggctggcgcgg
cgcgtcgccgagatccgggcggccggcgacgtccccttggtcttcggcggcgattgcagc
ctggtggtgggagtagggctcgcgctgcgcccagccggccggttcgccctggtgcatctg
gacggacacacggatttccgcaaccccggcaactccgacgcctgcgcggcgctggccggc
gaggatctggccgcggccatcggacgccactggccggcgatcgcggacgtcgacgggctc
ggaccgtacttcgacccggcggacaccgtgcacgccggatgccgggacgacgaccaggaa
ctcgccgaagtcgaagaggcgatcagcctcacgatccccgcctcggcgatcatccgcgac
ggcgccgcggccaccgccgaccgcgtccgcgagcgtgtcgagcgcgcagatctcgacggc
tactggctgcacctcgacgtcgacatcctcgacgcaaccgtgatgcccgccgtcgacagc
cccgaccccggcggcctgctcccggatcagctgaccgagctgctcgccgccctagccccc
ggcgcggccggcgcgcacgtcgccgtcttcgaccccgacctcgacccggacggccgccac
gcgcggctgctcacggacatcgtgaccgacggtctcggacagctcggcacagagctgaag
ccggccgcggcacacaacgcagaacgctga

DBGET integrated database retrieval system