KEGG   Catenulispora acidiphila: Caci_8322Help
Entry
Caci_8322         CDS       T00967                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cai  Catenulispora acidiphila
Pathway
cai00860  Porphyrin and chlorophyll metabolism
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01120  Microbial metabolism in diverse environments
Module
cai_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caci_8322
Enzymes [BR:cai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Caci_8322
Exosome [BR:cai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Caci_8322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACU77145
UniProt: C7QKP6
Position
complement(9647483..9648454)
Genome map
AA seq 323 aa AA seqDB search
MSFPLDRPRRLRTTPAMRRLAAETRLHPADFILPLFVKETITEPAPITSMPGVLQHTLAS
VRKAAAEAVAEGLGGIMLFAVPAEKDARGTTGTDPDGILQRTLAEVRDEVGDRIVVMSDL
CLDEFTDHGHCGVIREDGTVDNDATLERYAEMAVRQAAAGAHMVGPSGMMDGQVAVIRRA
LDESGFQDTAILAYSAKYASAFFGPFREAVESSLEGDRRTYQQDPANARESLREVRLDIE
EGADMVMVKPALSYLDIVRQVADISEVPVAAYQVSGEYAMVEAAAAAGWLDRERTILETL
TSVRRAGATSVLTYWAVEAARML
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcccgctggaccgcccccgccgcctgcgcaccaccccggccatgcgccggctc
gccgccgagacccgtctgcacccggccgacttcatcctgccgctgttcgtcaaggagacg
atcaccgagccggcgccgatcacctcgatgcccggggtcctgcagcacacgctggcgtcg
gtgcggaaggccgcggccgaggcggtcgccgaagggctcggcggcatcatgctgttcgcc
gtcccggcggagaaggacgcgcgcggcacgaccggcaccgaccccgacggaatcctgcag
cggaccctggccgaagtccgcgacgaggtcggcgaccgcatcgtcgtcatgtcggatctg
tgcctggatgaattcaccgatcacggacattgcggagtcatccgggaagacggcaccgtc
gacaatgacgccaccttggagcgctatgcggaaatggccgtccgccaggccgcggccggc
gcgcatatggtcggtccgagcgggatgatggacgggcaggtagccgtaatccgccgcgct
ctggacgaatcgggctttcaggacaccgccatactcgcctattccgcgaaatacgcgagc
gccttcttcggtcccttccgtgaggccgtcgagtccagcctggagggcgaccggcgcact
tatcagcaggacccggccaatgcccgcgaatccctgcgggaagtccgcctcgacatcgag
gagggcgcggacatggtcatggtcaagcccgcgctgtcctatctggacatcgtccgccag
gtcgcggacatctccgaggttccggtagccgcctaccaggtctccggcgagtacgcgatg
gtcgaggccgcggccgccgcgggctggctggaccgggagcggaccatcctggagacgctg
acctcggtgcgccgggcgggcgccacttcggtgctgacgtactgggccgtggaggccgcg
cgcatgctttag

DBGET integrated database retrieval system