KEGG   Catenulispora acidiphila: Caci_8507Help
Entry
Caci_8507         CDS       T00967                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
cai  Catenulispora acidiphila
Brite
KEGG Orthology (KO) [BR:cai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Caci_8507
Enzymes [BR:cai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Caci_8507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP_C
Motif
Other DBs
NCBI-ProteinID: ACU77330
UniProt: C7PYK8
Position
9866732..9867472
Genome map
AA seq 246 aa AA seqDB search
MTTVRAVAHIHSEWSDDASWPLDRLAAAFRKRGRSVLLMCEHSRTFTEAKWDEYVQACAA
ASGDGVLVVPGLEYNDSDNVVHIPVWGDVPFLSQTPDIADVLAHTRAADGVAVFAHPWRR
NAWRRFDPAWAKDLTAVEIWNRKYDGWAPNRQARAYAERLGLPPFVALDFHGARQFFPLA
MELTLTGAPTRTTVEDALRDGRFEPLAFSRSALRLTSGVGGMALAAAEAARAVAARTVRA
ALNKRK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacagtccgcgcggtggcccacatccactccgagtggtccgacgatgcctcctgg
ccgctcgaccgcctcgccgccgcgttccgcaagcgcggtcgcagcgtcctgctgatgtgc
gaacacagccgcaccttcaccgaagccaagtgggacgagtacgtccaggcgtgcgcggcg
gcctccggcgacggcgtcctcgtcgtccccggcctggagtacaacgacagcgacaatgtc
gtccacatcccggtctggggcgacgtcccgttcctgagccagacccctgatatcgccgac
gtcctggcccacacccgcgccgcggacggcgtcgccgtcttcgcgcacccctggcgccgc
aacgcctggcgccgcttcgacccggcctgggccaaggacctgaccgccgtggagatctgg
aaccgcaaatacgacggctgggcaccgaaccgccaagcccgcgcctacgccgagcgcctg
ggcctaccgcccttcgtcgccctggacttccacggcgcccgccagttcttccccctggcg
atggagctcaccctcaccggcgcaccgacccgcacgaccgtcgaggacgccctgcgcgac
ggccgcttcgaaccgctcgcgttcagccgctcggccctgcgcctgacctcaggcgtcggc
ggtatggccctggcagccgccgaagccgcgcgtgccgtggcagcccgaaccgtccgagcc
gcactgaacaaaaggaagtag

DBGET integrated database retrieval system