KEGG   Campylobacter iguaniorum: CIG1485E_1011Help
Entry
CIG1485E_1011     CDS       T03252                                 

Definition
(GenBank) acyl-CoA hydrolase/transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
caj  Campylobacter iguaniorum
Pathway
caj00020  Citrate cycle (TCA cycle)
caj00620  Pyruvate metabolism
caj00650  Butanoate metabolism
caj01100  Metabolic pathways
caj01110  Biosynthesis of secondary metabolites
caj01120  Microbial metabolism in diverse environments
caj01130  Biosynthesis of antibiotics
caj01200  Carbon metabolism
Module
caj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
caj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:caj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CIG1485E_1011
   00620 Pyruvate metabolism
    CIG1485E_1011
   00650 Butanoate metabolism
    CIG1485E_1011
Enzymes [BR:caj01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CIG1485E_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans THB
Motif
Other DBs
NCBI-ProteinID: AII14848
UniProt: A0A076FB10
Position
complement(1020833..1022365)
Genome map
AA seq 510 aa AA seqDB search
MIDNTISDTSRIKDARFLTKLIKADEAAALISHGSTVGFSGFVGAGSPLYVPLAIANKAQ
NMHEQGKEYQINVFSGASTDVDLDGALAKAEAVAFRTPFNTDPNMRAAINSGATRYVDVH
LSSLAWQVEAGYFGNMDFAVIEISGITENGELIPTTSVGNNQSWLNYADKIILELNIHQP
KELDGFHDVYHQPLPPHREPIPIKTPRDRVGSPYMKVDFNKVVGVVLSSTEDRLNKFTPL
DEISIAIGDNVVKFLENEVEAGRLPKGKLLPLQSGIGNVANAVLAGLTKAGYKGLECYSE
VIQDGMLELIKHGTVDFASASALSLSPSAVEEFRKNVDFYKEHIVLRPQEISNSPEAIRR
LGVIAMNGMLEADIYGNVNSTNVMGTNMMNGIGGSGDFARNGYLSLFLTPSMAKGGAISA
IVPFVSHLDHTEHDSMVIVTEYGFADLRGLSPKERAKKMIAIAHPDFRDMLQDYFDRACE
QPKAGHTPHLLDEALSWHSRFKKTGTMKKD
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgatagacaataccattagtgatactagtcgcataaaagatgctagatttttgactaaa
cttatcaaggctgatgaggctgctgcgcttataagtcatggatctactgtgggttttagc
ggatttgttggtgctggaagcccactttacgtgcctttagcaatagccaacaaagcccag
aatatgcacgagcaaggaaaagaatatcaaataaatgtattttctggagctagcaccgat
gtggatttagacggagctttggcaaaagctgaggctgtggcgtttagaactccttttaac
actgatccaaatatgagagcagctataaactctggagctacaagatacgtcgatgttcac
ctctcaagcttggcttggcaagtagaagctgggtattttggtaacatggattttgcagtt
attgaaatttctggcattactgaaaatggggagcttatcccgaccacttcagtgggcaac
aatcaatcatggctgaattacgctgataaaatcatacttgagctaaatatccaccaacca
aaagagcttgatggcttccatgatgtctatcatcagccacttcctccgcaccgtgagcca
atccctataaaaacgccaagagaccgcgtgggaagtccttatatgaaagttgattttaat
aaagtcgtcggagtggttttaagctcaacagaagataggctaaataaatttacaccactt
gatgagatttctatcgcgattggtgacaatgtcgttaaatttttggagaatgaagttgag
gctggacgacttccaaaaggcaagcttctaccacttcaaagcggtataggaaacgtcgca
aatgctgtacttgctggacttacaaaagctggatataaaggtcttgagtgctactctgag
gtcatccaagatggtatgctagagcttatcaaacacggaactgtggattttgcttcggct
tcagctctttcacttagcccaagcgctgttgaggagtttagaaaaaatgttgatttttat
aaagaacatatagttttacgccctcaagagatatcaaatagcccagaagcgattcgccgt
ttaggcgtcatagcgatgaacggaatgcttgaagctgatatttatggaaacgtgaattca
acaaatgtcatgggaacaaatatgatgaatggcattggtggaagtggagattttgctaga
aatggctatctttcgctatttctaactccgtctatggctaaaggtggggcgatttctgct
attgtgccttttgtgagccatttggatcacacagaacacgatagtatggtcatcgtgact
gagtatgggttcgctgatttgcgtggtcttagcccaaaagagcgtgctaaaaaaatgata
gctatcgctcatcctgattttagagatatgcttcaagattattttgatagagcgtgtgag
cagccaaaagcggggcatacgcctcatcttttagatgaagctcttagctggcatagtcgc
ttcaaaaaaactggaacaatgaaaaaagactaa

DBGET integrated database retrieval system