KEGG   Caulobacter sp. K31: Caul_0125Help
Entry
Caul_0125         CDS       T00651                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cak  Caulobacter sp. K31
Pathway
cak00071  Fatty acid degradation
cak00280  Valine, leucine and isoleucine degradation
cak00281  Geraniol degradation
cak00310  Lysine degradation
cak00362  Benzoate degradation
cak00380  Tryptophan metabolism
cak00410  beta-Alanine metabolism
cak00640  Propanoate metabolism
cak00650  Butanoate metabolism
cak00903  Limonene and pinene degradation
cak00930  Caprolactam degradation
cak01040  Biosynthesis of unsaturated fatty acids
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01120  Microbial metabolism in diverse environments
cak01130  Biosynthesis of antibiotics
cak01200  Carbon metabolism
cak01212  Fatty acid metabolism
Module
cak_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Caul_0125
   00650 Butanoate metabolism
    Caul_0125
  Lipid metabolism
   00071 Fatty acid degradation
    Caul_0125
   01040 Biosynthesis of unsaturated fatty acids
    Caul_0125
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Caul_0125
   00310 Lysine degradation
    Caul_0125
   00380 Tryptophan metabolism
    Caul_0125
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Caul_0125
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Caul_0125
   00281 Geraniol degradation
    Caul_0125
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Caul_0125
   00930 Caprolactam degradation
    Caul_0125
Enzymes [BR:cak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Caul_0125
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Caul_0125
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Caul_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 FAD_binding_3 DAO DUF2680
Motif
Other DBs
NCBI-ProteinID: ABZ69263
UniProt: B0T294
Position
complement(137527..139725)
Genome map
AA seq 732 aa AA seqDB search
MENFKIEVDGDGIALVTFDVPGRTMNTLTASVIKEIGDVVETIKSDAAIKGAVITSGKTT
GFCAGADLGELGGSGGLAGAGSGEEGLKAAFEAGFALNKAFRALETCGKPVAAAINGLAM
GGGLEITLACHYRVVADNPKIQLALPEAKVGLLPGAGGTQRLPRLIGVMAAAPYLLEGKS
MKPAEALALKVVHEVVPADQVVEAAKTWVKTKGDAVAPWDKKDFKLPGGGPYTPGGSQVF
VMGNAMLRKSTYGNYPAQLNIMKAVYEGTQVPFDAALRIETRYFLKTMMTPQAKGMIRTL
FLSLQELGKGSGRPAGVPHYDVKKVAVLGAGMMGAGIAYVQAMAGIETVLIDQTQEAADK
GKGYAEALVNKAVSRGKMTKEKGEGILALIHPTADYANVKGSDLVVEAVFENRDVKASVT
KLAEAQLADTAIFGSNTSTLPITGLAKASVRPASFIGIHFFSPVDKMGLVELIMGDETSQ
EALAKSIDYVLKIKKTPIVVNDSRGFYTSRCFGTFVQEGMELLADGYAPAIIDNVGRATG
MPRGPLEMHDDVALDLSYKIAQQTKKDLGDKYEERPFTTIIEKMVEGEGRYGRKNGKGFY
DYPENGPKVLWKGLADLAPVKIAEVDKAGIEEIRTRLLYRQAVEAARCFEEGVITDPREA
DVGAILGWGFAPWTGGPVSLIDGVGVAKFVEACDALAQKYGARFAPPQLLRDMAAKGETF
YSRFGVKEKAAA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacttcaagatcgaggtcgacggcgacgggatcgccctggtcaccttcgacgtg
cccggccggacgatgaacaccctgaccgcctcggtgatcaaggaaatcggcgacgtcgtc
gagaccatcaagagcgacgccgccatcaagggcgcggtcatcacctcgggcaagacgacc
ggcttctgcgccggcgccgacctgggcgaactgggcggctccggcggcctggctggcgcg
ggttcgggcgaggagggcctgaaggccgccttcgaagccggcttcgcgctcaacaaggcg
ttccgcgccctggaaacctgcggcaagccggtggccgcggccatcaacggcctagccatg
ggcggcggcctggagatcaccctggcctgccactaccgcgtcgtggccgacaatcccaag
atccagctggccctgccggaagccaaggtcggcctgctgcccggcgccggcggcacccag
cgcctgccgcgcctgatcggcgtgatggccgccgcgccgtacctgctggaaggcaagtcg
atgaagccggccgaggcgctggcgctgaaggtcgtgcatgaagtcgtgccggccgaccag
gtggtcgaggccgccaagacctgggtcaagaccaagggcgacgccgtcgccccgtgggac
aagaaggacttcaagctgcccggcggcggtccctacacccccggcggcagccaggtgttc
gtgatgggcaacgccatgctgcgcaagagcacctatggcaactatccggcccagctgaac
atcatgaaggcggtctatgagggcacccaggtgccgttcgacgccgccctgcggatcgag
acccgctatttcctcaagaccatgatgacgccccaggccaagggcatgatccgcaccctg
ttcctcagcttgcaggaactgggcaagggctcgggccgtccggccggcgtgccgcactac
gacgtcaagaaggtggccgtgctcggcgccggcatgatgggcgcgggcatcgcctatgtg
caggccatggccggcatcgagaccgtgctgatcgaccagacccaggaagccgccgacaag
ggcaagggctatgccgaggccctggtcaacaaggccgtgtcgcgcggcaagatgaccaag
gaaaagggtgagggcatcctggccctgatccacccgaccgccgactacgccaacgtcaag
ggcagcgacctggtggtcgaggccgtgttcgagaaccgcgacgtgaaagcgtcggtcacc
aagctggcggaagcccagctggccgacaccgcgatcttcggctccaacacctcgaccctg
ccgatcaccggcctggccaaggcgtcggtgcgtcccgcctcgttcatcggcatccacttc
ttctcgccggtcgacaagatgggcctggtcgagctgatcatgggcgacgagacctcgcag
gaggccctggccaagtcgatcgactacgtcctgaagatcaagaagaccccgatcgtcgtc
aacgactccagaggcttctatacgtcgcgctgcttcggcaccttcgtgcaggaaggcatg
gagctgctggccgacggctacgccccggccatcatcgacaatgtcggccgggccaccggc
atgccgcgcggtccgctggagatgcacgacgacgtcgcgctggacctgtcctacaagatc
gcccagcagaccaagaaggacctcggcgacaagtacgaggagcgccccttcaccacgatc
atcgagaagatggtcgaaggcgagggccgctacggccgcaagaacggcaagggcttctac
gactatccggagaacggccccaaggttctgtggaagggcctggccgacctggcgccggtc
aagatcgccgaggtcgacaaggccggcatcgaggagatccgcacccggctgctctaccgc
caggccgtggaagccgcccgctgcttcgaggaaggcgtgatcaccgacccgcgcgaggcc
gacgtcggcgccatcctgggctggggcttcgcgccctggaccggcggcccggtcagcctg
atcgacggcgtcggcgtggccaagttcgtcgaggcctgcgacgccctggcccagaagtac
ggtgcgcgtttcgccccgccgcagcttctgcgcgacatggccgccaagggcgagaccttc
tacagccgcttcggcgtcaaggagaaggccgccgcctga

DBGET integrated database retrieval system