KEGG   Caulobacter sp. K31: Caul_0874Help
Entry
Caul_0874         CDS       T00651                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
cak  Caulobacter sp. K31
Pathway
cak00361  Chlorocyclohexane and chlorobenzene degradation
cak00625  Chloroalkane and chloroalkene degradation
cak01100  Metabolic pathways
cak01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cak00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Caul_0874
   00361 Chlorocyclohexane and chlorobenzene degradation
    Caul_0874
Enzymes [BR:cak01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Caul_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like DUF2608
Motif
Other DBs
NCBI-ProteinID: ABZ70005
UniProt: B0SVG6
Position
929046..929663
Genome map
AA seq 205 aa AA seqDB search
MTPARPPRALLWDVGNVIVRWNPRTLYAKIFKEPADLDRFLSRVGTLDWHAATDRGVTFA
DNIAALSAQHPHHADHIAAWWDRWDEMFSGTILETESVIEDLAARGVPQFGLTNMSSESW
PGVKAMSPAFRHFRDAVVSAEERVIKPEPRIYEIVLERTGLEPADLLFVDDSAANIAAAD
ALGFHTHHFTDPAALRPAVERHGLL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgcgcggcctcccagggcgctgctctgggacgtcggcaacgtcatcgtgcgc
tggaatccgcgcacgctctacgcgaagatcttcaaggaaccggccgatctcgaccggttc
ctttcgcgtgtcgggaccctggactggcacgcggcgaccgaccgcggcgtgaccttcgcc
gacaacatcgccgccctgagcgcccagcacccccaccacgccgaccacatcgccgcctgg
tgggatcgctgggacgagatgttttccggaacgatccttgagaccgaatccgtcatcgag
gacctggccgcgcgcggcgtgccgcagtttggcctgaccaacatgtccagtgaaagctgg
cccggcgtgaaggccatgagccccgccttccgccatttccgcgacgcggtggtgtcggcc
gaagagcgggtcatcaagcccgaaccgcgaatctacgagatcgtgctggagcggacgggc
ctggagcccgccgacctgctgttcgtcgatgacagcgccgccaatatcgcggccgccgac
gccctgggcttccacacccaccacttcaccgacccggcggccctgcggccggcggtggag
cgccacggcttgctctag

DBGET integrated database retrieval system