KEGG   Caulobacter sp. K31: Caul_1210Help
Entry
Caul_1210         CDS       T00651                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cak  Caulobacter sp. K31
Pathway
cak00010  Glycolysis / Gluconeogenesis
cak00260  Glycine, serine and threonine metabolism
cak00680  Methane metabolism
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01120  Microbial metabolism in diverse environments
cak01130  Biosynthesis of antibiotics
cak01200  Carbon metabolism
cak01230  Biosynthesis of amino acids
Module
cak_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caul_1210
  Energy metabolism
   00680 Methane metabolism
    Caul_1210
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caul_1210
Enzymes [BR:cak01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Caul_1210
Membrane trafficking [BR:cak04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Caul_1210
Exosome [BR:cak04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Caul_1210
  Exosomal proteins of melanoma cells
   Caul_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABZ70340
UniProt: B0SY17
Position
1272719..1273432
Genome map
AA seq 237 aa AA seqDB search
MPVLVLLRHGQSQWNLENRFTGWVDVDLTAEGEAQARKGGELIKAAGINLDEAFTSVQTR
AIRTGNLALDAAGQSFVPVTKDWRLNERHYGGLTGLNKAETAQKHGEEQVTIWRRSYDIP
PPPLAPGGEYDFGKDRRYAGKDLPDTESLKTTLTRVLPYWETAIAPKLKAGETILVAAHG
NSLRAIVKHLFDVPDDKIVHVEIPTGNPLVIDLDADLKPTGARYLDAARAQPLPAVG
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcctcgtcctgctccgccatggccaaagccagtggaatctcgaaaaccgcttc
accggctgggtggacgtcgacctgaccgccgagggcgaggcccaggcccgcaagggcggc
gaactgatcaaggcggccggcatcaacctcgacgaggccttcacctcggtccagacccgc
gcgatccgcaccggcaacctggcgctggacgccgccggccagagcttcgtgccggtgacc
aaggattggcgcctgaacgagcgtcactacggcgggctgacgggcctgaacaaggccgag
accgctcagaagcacggcgaggagcaggtgaccatctggcgccggtcctacgatatcccg
ccgccgcccctggcgcccggcggcgagtacgacttcggcaaggatcgccgctatgccggc
aaggacctgccggacaccgaaagcctgaagaccaccctgacccgcgtcctgccctactgg
gagaccgcgatcgcgcccaagctgaaggccggcgagacgatcctggtcgccgcccacggc
aattcgctgcgcgccatcgtcaagcatctgttcgacgtgcccgacgacaagatcgtccat
gtcgagatccccaccggcaatccgctggtcatcgacctggacgccgacctgaagccgacc
ggcgcccgctatctcgacgccgcccgcgcccagccgctgcccgcggtggggtga

DBGET integrated database retrieval system