KEGG   Caulobacter sp. K31: Caul_1517Help
Entry
Caul_1517         CDS       T00651                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cak  Caulobacter sp. K31
Pathway
cak00240  Pyrimidine metabolism
cak00250  Alanine, aspartate and glutamate metabolism
cak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Caul_1517
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Caul_1517
Enzymes [BR:cak01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Caul_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABZ70647
UniProt: B0T190
Position
complement(1610128..1611135)
Genome map
AA seq 335 aa AA seqDB search
MTAKAPPAPHDPARAIDPILERIFSFPRRHFLSAGDLNAPQATDLLDLADAFVAFNRQTS
KSLDILKGRTLMNLFFENSTRTQSSFEIAGKRLGADVVNMSPRTSSITKGETLIDTAVTL
NAMRPDLLVVRHASSGAASLLSQKVSGSVINAGDGQHEHPTQAVLDALSIRRAFGRVSGL
TVAICGDVLHSRVARSNVALLHTLGASVRLVGPPTLMPAQAERWGVTVHHDMKAGIAGAD
VVMMLRLQLERMQGAFVPSTREYFRFYGLDREKLARAAPKAKVMHPGPMNRGVEIDSDVA
DDPEISLIQDQVEMGVAARMAVLASLAHRLEEHGQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaaagccccccccgctcctcatgaccccgcgagagcgatcgatccgatcctc
gagcgcatcttttccttcccccggcgccacttcctgtcggccggcgacctgaacgccccg
caggccaccgatctgctggacctggccgacgccttcgtcgccttcaaccgccagacgtcc
aagtccctcgacatcctcaagggccggacgctgatgaacctgttcttcgagaacagcacc
cgcacccagagctcgttcgagatcgccggcaagcgcctgggcgccgacgtggtcaacatg
agcccgcgcacctcgtcgatcaccaagggcgagaccctgatcgacaccgccgtgaccctg
aacgccatgcggcccgacctgctggtggtgcgccacgcctcgtcgggcgcggcgtcgctg
ctcagccaaaaggtcagcggcagcgtcatcaacgccggcgacggccagcacgagcacccc
acccaggcggtgctggacgccctgtcgatccgccgcgccttcggccgggtctcgggcctg
accgtggcgatctgcggcgacgtgctgcacagccgcgtggcccgctcgaacgtcgccctg
ctgcacacgctgggcgccagcgttcggctggtgggaccaccgaccctgatgccggcccag
gccgagcgctggggcgtcaccgtccatcacgacatgaaggccggcatcgccggggccgac
gtggtgatgatgctgcgcctgcagctggagcgcatgcagggggcgttcgtgccctcgacc
cgcgaatatttccgcttctacggcctggaccgcgagaagctggcccgcgccgcgcccaag
gccaaggtcatgcacccgggtccgatgaaccggggcgtcgagatcgattccgacgtcgcc
gacgatcccgagatcagcctgatccaggaccaggtcgagatgggcgtcgccgcccgcatg
gccgtcctggccagcctggcccaccggctcgaggagcacggtcagtga

DBGET integrated database retrieval system