KEGG   Caulobacter sp. K31: Caul_1663Help
Entry
Caul_1663         CDS       T00651                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K15918  D-glycerate 3-kinase [EC:2.7.1.31]
Organism
cak  Caulobacter sp. K31
Pathway
cak00260  Glycine, serine and threonine metabolism
cak00561  Glycerolipid metabolism
cak00630  Glyoxylate and dicarboxylate metabolism
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01130  Biosynthesis of antibiotics
cak01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Caul_1663
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Caul_1663
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caul_1663
Enzymes [BR:cak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.31  glycerate 3-kinase
     Caul_1663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 MeaB SRP54 MobB AAA_16 PRK AAA_33 AAA_18 ABC_tran AAA_22 AAA ATP_bind_1 TsaE Thymidylate_kin NTPase_1 LpxK Rad17 APS_kinase cobW CbiA Zeta_toxin AAA_5 ParA AAA_23 KTI12 AAA_28 PEP-utilizers_C AAA_14 AAA_19
Motif
Other DBs
NCBI-ProteinID: ABZ70792
UniProt: B0T2H1
Position
1741791..1742666
Genome map
AA seq 291 aa AA seqDB search
MIDPDWLAAFLRDERLPAAFADEIERLHAPLAARIAAVAMGSAFVVGICGPQGAGKTTTV
RVLAALLEAQGLSVAILSLDDLYLPRADREALARDVHPLLRTRGVPGTHDVALGLAVLDG
LATAGKTTIPRFDKAADDRAPAESWSRVEGPVDVVLFEGWCVGARPELAEALRQPLNALE
REQDPEGVWRRYVNAALAGPYRALFARVDLLIQFTAPDFETVLAWRQEQERKLRDRLAAA
GQGGAGRAMTEAEVAVFVQHYERLTRHIAHEMPARADLVVALGADRRSSNI
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcccgactggctggccgccttcctgcgcgacgagcgtctgcccgccgccttc
gccgacgagatcgagcgcctgcacgcgccgctggccgcccgcatcgcggcggtggcgatg
gggtccgccttcgtggtcgggatctgcgggccgcagggggcgggcaagacgaccaccgtc
cgggtgctggccgcgctgctcgaagcccagggcctgagcgtggcgatcctgtcgctggac
gacctctacctgccgcgcgccgatcgcgaggccctggcccgcgacgttcatcccctgctg
cgcacccggggcgtccccggcacgcacgacgtcgccctgggcctggcggtgctggacggc
ctggcgaccgccgggaagacgacgatccctcgcttcgacaaggccgccgacgaccgcgcg
ccggccgagtcgtggtcaagggtcgaagggccggtcgatgtcgtgctgttcgaaggctgg
tgcgtcggcgcccgtcccgagctggccgaggcgctgcgccagccgctcaacgccctcgag
cgcgagcaagaccccgagggcgtctggcggcggtatgtcaacgccgccctggccggcccc
tatcgcgccctgttcgcccgcgtcgacctgctgatccagttcaccgcgccggacttcgaa
accgtcctggcctggcgccaggagcaggagcgcaagctgcgcgatcggctggcggcggcc
gggcagggtggagcgggccgggcgatgaccgaggccgaagtcgccgtcttcgtccaacat
tacgagcgcctgacccgtcatatcgcccacgaaatgccagcccgcgccgacctcgtcgtg
gcgctaggcgccgaccgtcgttcgtcgaacatttga

DBGET integrated database retrieval system