KEGG   Caulobacter sp. K31: Caul_2030
Entry
Caul_2030         CDS       T00651                                 
Name
(GenBank) CagE TrbE VirB component of type IV transporter system
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
cak  Caulobacter sp. K31
Pathway
cak02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cak00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Caul_2030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cak02044]
    Caul_2030
Enzymes [BR:cak01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Caul_2030
Secretion system [BR:cak02044]
 Type IV secretion system
  Trb secretion system protein
   Caul_2030
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 TraG-D_C Zot
Other DBs
NCBI-ProteinID: ABZ71158
UniProt: B0T6U3
Position
2172043..2174484
AA seq 813 aa
MLNLREYRDTADRLADHLPWAALVAPGVVLNKDGGFQRTFRFRGPDLESATEAELVGVCA
RANNALKRLGSGWALFFDADRAPALGYPDSVFPDAASWLVDEERRGGFDGRRGELFETRC
HLTFFYLPPADQVSRAERALIEREADRQGRDWRQELRAFIAQTDRVLDLLSGFMPLIRPL
DDAETLTFLHAAISAKRHRVAVPETPMYLDGLLVDTPFSGGIEPRLGDRHLRTVTVLGFP
NTTRPGLLDALNHQGFAYRWTTRFIALDKPDAAKALGRIRRQWFNKRKSVVQILREVISN
EPAPLTDSDADNQLADADLALQELGGDLVAFGYLTTTITVMDADREAAEEKVRQVERILG
GLGFTAMREQVNAVEAWLGSLPGQVYANVRQPLVHTLNLAHLMPLSSVWAGQAGNAHLKG
PPTFYAVTSGSTPFRYSTHLEDVGHQLHAGPTGAGKSVLLALLELQFRRYPRAQVYVFDK
RFSSRAAVLAMGGRHHGLAADAGLAFQPLRGIDDAGERAWAIEWLCDLIANENVLVTPSI
KETLWSALGSLASAPAAERTLTGLSMLLQSNDLKMALAPYTLDGPFGRLLDAAEDGLDLS
DVQCFETDTLIKTPTVVAPVLTYLFHRLEARFDGRPTLMVLDEAWKFLDTPLFAARIREW
LKELRKRNVAVIFATQSLADIVDSPIMPAIIDGCPQRIFLANDRAIEPLSRKVYEGLGLN
ERQIELIARATPKRHYYLQSRLGNRLFELGLGPVALALCGASDPSVQAQIDQVLAEHGEA
GFAAGFLAARGLPWASALITDFVPPTPSEEITP
NT seq 2442 nt   +upstreamnt  +downstreamnt
atgctgaaccttcgcgaataccgtgacaccgccgatcgcctggccgatcacctgccctgg
gcggcgctggtcgcccccggcgtcgtgctcaacaaggacggcggcttccaacgcaccttc
cggtttcgcggtcccgatctcgaaagcgccaccgaggccgagttggtcggcgtctgcgcg
cgggccaacaacgccctcaagcgcctgggcagcggctgggcgctgttcttcgacgccgat
cgcgccccagccctgggctatcctgacagtgtctttcccgacgccgcctcctggctggtg
gacgaggagcggcgcggcggctttgacgggcggcggggtgagctttttgagacccgctgc
cacctgaccttcttctacctgccgccggccgaccaagtcagccgggccgagcgcgccctg
atcgagcgcgaggccgaccgtcaggggcgcgattggcgccaggaattgcgggccttcatc
gcccagaccgacagggtcctggatctactgtcgggcttcatgccgctgatccgtccgctg
gacgacgccgagaccctgaccttcctgcacgcggcgatctcggccaaacgccatcgcgtc
gccgtccccgagacgccgatgtacctggacggccttctggtcgacaccccgttcagcggc
gggatcgaaccgcggctgggcgaccggcatctgcgaacggtcactgtgctgggttttccc
aacaccacgcggccagggctgctcgacgccctgaaccaccagggcttcgcctatcgctgg
accacccggttcatcgccctggacaagcccgacgcggccaaggccctggggcgcatccgc
cgccagtggttcaacaagcgaaaatccgtcgtccagatcctgcgcgaggtgatcagcaac
gagcccgcgccgctgaccgacagcgacgcggacaaccagctggccgacgccgacctggct
ttgcaagagctgggcggggacctggtcgcctttggctacctgaccacgaccatcaccgtg
atggacgccgatcgcgaggccgccgaggagaaggtgcgccaggttgagcggatcctgggc
ggccttggcttcaccgccatgcgcgagcaggtcaacgcggtcgaggcctggctcggctcg
ctaccaggccaggtctacgccaatgtgcgccagcctctggtccacacgctgaacctggcc
cacctgatgccgctgtcgtcggtatgggccggacaggcgggcaatgcccatctcaagggg
ccgccgaccttctacgccgtgaccagcggttcgacgccgtttcgctattcgacccatctg
gaggatgtgggccaccaactgcacgccggtccgaccggcgcgggcaagtcggtactcttg
gcgctgctggaactgcagtttcgccgctatccacgcgcgcaggtctatgtcttcgacaag
cgcttctcctctcgcgccgcggtcctggccatgggcgggcgccatcatggcttagcggcg
gacgcgggcctggccttccagccgctccgggggatcgacgatgcgggcgaacgggcctgg
gcgatcgagtggttgtgcgacctgatcgccaacgagaacgtgctcgtcacgccatcgatc
aaggagacgctctggtcggcgttgggaagcctggccagcgccccggcggccgagcggacc
ctgaccggcctgtcgatgttgctgcagtcgaacgacctgaagatggctctggcgccctac
acgctggatggacctttcggccggctgctggacgcggccgaggacggtttggacctcagc
gacgtccagtgcttcgagaccgacaccctgatcaagacgccgacggtcgtcgcgccggtc
ctgacctacctcttccatcggctggaggcgcggttcgatggccgtcccaccctgatggtg
ctcgacgaggcgtggaaattcctggacacgcccctgttcgccgcgcgcatccgcgaatgg
ctcaaggaactgcgcaagcgcaacgtcgcggtgatcttcgccacccagtcgctggccgac
atcgtcgacagtccgatcatgccggcgatcatcgacggctgcccgcagcgcatcttcctg
gccaacgaccgagcgatcgagccgttgtcgcgcaaggtctacgagggcttggggctcaat
gagcgccagatcgagctgatcgcccgcgcgacgcccaagcgccactactacctgcaatcg
cgcctgggcaatcgcctgttcgagctgggtctggggccggtggctttggcgctttgtggc
gcgtccgacccttccgtgcaggcccagatcgaccaggtcctggccgagcatggcgaggcg
ggcttcgcggccggcttcctggctgcccggggcctgccgtgggccagcgccctgatcact
gacttcgtccctccaaccccctcagaggagatcacgccatga

DBGET integrated database retrieval system