KEGG   Caulobacter sp. K31: Caul_2067Help
Entry
Caul_2067         CDS       T00651                                 

Definition
(GenBank) glycoside hydrolase family 30
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
cak  Caulobacter sp. K31
Pathway
cak00511  Other glycan degradation
cak00600  Sphingolipid metabolism
cak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Caul_2067
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Caul_2067
Enzymes [BR:cak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Caul_2067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: ABZ71195
UniProt: B0T6Y0
Position
2207303..2208745
Genome map
AA seq 480 aa AA seqDB search
MTIKVPVRRPAARLGAAALLLGLAACATTPPVVPTHAGAWITTADRSQMLAAQPALVFGS
EDVALGLPVITVDAAERHQSMVGFGAAITDASAWLIQNRLTPDQREQLLRELYGRGEGEL
GFSFTRLTIGASDFSSEHYSLDDAPGGAADPELAHLSLGRPAQAVFPTVRQVLAINPDLK
VMASPWSAPAWMKTTGSLIKGQLKSEAYPTYARFFVRYVDGAAKLGVPIDYLSIQNEPDF
EPENYPGMRWGAADRARFIGENLGPAFKQHGVRTRILEWDHNWDQPQQPLTALADPKAAP
FIAGVAWHCYAGDVAAQAKVAGAHPDKDVFFTECSGGDWSGPFDESFGWLMRNLVIGSTR
NGARGVLMWNLALDETHGPHKGGCGDCRGVVTIDSRTGAITRNPEYYAFGHASRFVRPGA
VRIDSSETASLPSVAFRNPDGGRVLVVFNSGKDRQAFSVREGGRVAKTSLPGGAAATFVW
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaaagtccctgttcgacgcccagccgcgcgcctcggcgcggcggccctgctg
ctaggtctggcggcctgcgcgaccacgccgccggtcgtccccacccacgcaggagcatgg
atcaccacggcggaccggagccagatgctggcggcgcagcccgccctggtcttcgggtca
gaggacgtcgccctggggctgccggtgatcaccgtcgacgccgcggaacgccaccagagc
atggtcggtttcggcgcggcgatcaccgacgcctcggcctggctgatccagaaccggctg
acgcccgaccagcgcgagcaattgctcagggagctctatgggcggggcgagggggagctc
ggcttcagcttcacgcgcctgacgatcggcgcctcggatttctcgtccgaacactacagc
ctcgacgacgcgccgggcggcgcggccgatccggagctggctcacctgtcgctgggccgt
ccggcgcaggcggtcttcccgaccgtcaggcaggtcctggcgatcaatcctgatctcaag
gtcatggcctcgccctggagcgccccggcctggatgaagaccaccggctcgctgatcaag
ggccagctgaaatccgaggcctatccgacctatgcccgcttcttcgtgcgctatgttgac
ggggcggccaagctgggcgtgccgatcgactatctgagcatccagaacgagccggacttc
gagccggagaactatcctggcatgcgctggggcgcggccgatcgggcgcggttcatcggc
gagaacctggggccggcgttcaagcaacatggcgtgcggacccggatcctcgaatgggac
cacaactgggaccagccgcagcagcccctgaccgcgctggccgatccgaaggccgcgccg
ttcatcgccggcgtggcctggcactgttacgccggcgacgtcgccgcccaggccaaggtc
gccggcgcccatcccgacaaggacgtgttcttcaccgaatgctcgggcggcgactggtcg
ggtccgttcgacgaaagcttcggctggctgatgcgcaacctggtgatcggctccacccgc
aacggcgcccggggcgtgctgatgtggaacctggcgcttgacgaaacccacggaccgcac
aagggcggatgcggggactgtcggggcgtggtgaccatagacagccgcaccggcgcgatc
acccgcaaccccgaatactacgcctttggacacgccagccggttcgtgaggccgggcgcc
gtacggatcgactcgtcagaaaccgcgagcctgccgagcgtcgccttccgcaatcccgac
ggcggtcgcgtgctggtcgtcttcaattccggcaaggatcgccaggcgtttagcgtccgc
gagggcggtcgggtcgccaagacctcgctgccaggcggcgccgcggcgacgtttgtctgg
tag

DBGET integrated database retrieval system