KEGG   Caulobacter sp. K31: Caul_3588Help
Entry
Caul_3588         CDS       T00651                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cak  Caulobacter sp. K31
Pathway
cak00340  Histidine metabolism
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Caul_3588
Enzymes [BR:cak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Caul_3588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABZ72715
UniProt: B0T777
Position
complement(3871232..3872572)
Genome map
AA seq 446 aa AA seqDB search
MVLRIKTCTRPKNPHLGPMRRFNSADPAFPAAFKAFLDERRGAPENVDAAARNVLDAVKA
DGLAAVLSFTSRFDGVDLTEDTIRVTAEEIEAGAAQASSEVREAIAFAAKRIRAFHVRQR
PEDQSWTDEAGVQLGWRWTPLEAVGVYVPGGRAAYPSTVLMNAVPAQVAGVDRIAMVTPP
GKLEPAVLAAAKEAGVTEIWRIGGAQAVAALAYGAGPIQPVDKIVGPGNAYVTAAKRRLY
GVVGIDALAGPSEIVVVADAKNDPAWIAADLLSQAEHDPAAQSILITDDEAFAQAVSDAV
DALLGTLATGADAAESWRDHGAIILCPLDDSPRLVDLLAPEHVEFAIDAPERLADRVRHA
GAIFLGRLTPEAIGDYVAGSNHVLPTSRAARFQSGLSIYDFLKRTSIVKCDAAAFGVLGP
HTVALAKAEGLPAHALSASIRLPSKP
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgcgcatcaagacttgcacccgtcccaaaaacccgcatctaggccccatgcgt
cgcttcaattccgccgatcccgcctttcccgccgccttcaaggccttcctcgacgagcgc
cggggcgcgccggagaatgtcgatgcggccgcgcgcaacgtgctggacgccgtgaaggcc
gacggcctggccgccgtgctcagcttcaccagccgctttgacggggtggatctgaccgaa
gacaccatccgcgtcaccgccgaggagatcgaggccggcgccgcccaggcttcgtccgag
gtgcgcgaggccatcgccttcgccgccaagcgcatccgggccttccacgtccgccagcgc
cccgaagaccagtcgtggaccgatgaggccggcgtgcagttgggctggcgctggacgccg
ctggaggcggtgggcgtctatgtgcccggcggccgcgcggcctatccctcgaccgtgctg
atgaacgccgtgcccgcccaagtggccggggtcgaccgcatcgccatggtcaccccgccc
ggcaagctggagccggcggtgctggccgccgccaaggaggccggggtcaccgagatctgg
cggatcggcggggcccaggccgtcgccgccctggcctacggcgccggcccgatccagccg
gtcgacaagatcgtcggccctggcaacgcctatgtcaccgccgccaagcgccgcctctac
ggcgtggtcggcatcgacgccctggccggtccgtccgagatcgtcgtggtcgccgatgcg
aagaacgaccccgcctggatcgccgccgacctgctgagccaggccgaacacgacccggcc
gcccagtcgatcctgatcaccgacgacgaggccttcgcccaggcggtgtccgacgccgtc
gacgccctgctggggaccctggccaccggcgccgacgccgccgaatcctggcgcgaccac
ggcgccatcatcctgtgcccgctggacgacagcccgcgcctggtcgacctgctggcgccc
gagcacgtcgagttcgcgatcgacgcgcccgagcgcctggccgaccgggtgcgccacgcc
ggggcgatcttcctgggccgcctgacgccggaagccatcggcgactatgtggccggctcc
aaccacgtgttgcccaccagccgcgcggcgcgcttccagtcgggcctgtcgatctacgac
ttcctcaagcgcacctcgatcgtgaagtgcgatgcggccgcgttcggcgtcctgggtccg
cacaccgtggccctggccaaggccgagggcttgccggcccacgccctgtcggcgtcgatt
cggttgccttccaagccgtaa

DBGET integrated database retrieval system