KEGG   Caulobacter sp. K31: Caul_3669Help
Entry
Caul_3669         CDS       T00651                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cak  Caulobacter sp. K31
Pathway
cak00471  D-Glutamine and D-glutamate metabolism
cak00550  Peptidoglycan biosynthesis
cak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Caul_3669
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Caul_3669
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cak01011]
    Caul_3669
Enzymes [BR:cak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Caul_3669
Peptidoglycan biosynthesis and degradation proteins [BR:cak01011]
 Precursor biosynthesis
  Amino acid ligase
   Caul_3669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M 2-Hacid_dh_C Mur_ligase_C NAD_binding_2 IlvN TrkA_N NAD_binding_7 AdoHcyase_NAD AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABZ72796
UniProt: B0T833
Position
complement(3963749..3965158)
Genome map
AA seq 469 aa AA seqDB search
MIPVRGFEGKTVAVFGLGRTGLTAARALIAGGAKVALWDEKPESRQAAVAEGLNVVDLTT
SDWSDYAALMLSPGVPLTHPKPHWTVGKAKAAGVEVLGDIELFARTVNAAPEHKKPKIIA
ITGTNGKSTTTALIGHLCRQAGRDTRVGGNIGEGVLGLEDMHGGAVYVLELSSYQLDLTS
SLKPDAVVLLNISPDHLDRHGGMDGYIAAKRRIFLNQGKGDTAIIGVDDPWCQQICTEIT
AANRRTIWPISAGKAMGRGVYALQGVLYDATGERVTEMADLLRARSLPGRHNWQNAAAAY
AAAKAIGIPAHQAVDGLMSFPGLAHRMETVGKLGKVRFVNDSKATNADAARQAMSSYPKF
YWIAGGVPKAGGIDDLVDLFPRVAGAYLIGQAAEDFGKTLEGKAPARQCGDIETAVAAAY
ADAVASGEEAVVLLSPACASFDQFADFEQRGEAFRAAVNGLGKPAAKRA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgatcccggtccgcggtttcgagggcaagaccgtcgccgtgttcggcctgggccggacg
gggctgacggccgcgcgcgcgctgatcgccggcggggccaaggtggcgctgtgggacgaa
aagcccgagagccgccaggccgccgtggccgaggggctgaacgtcgtcgacctgaccacc
agcgactggagcgactacgccgccctgatgctgtcgccgggcgtgccgctgacccatccc
aagccgcactggacggtgggcaaggccaaggcggccggggtcgaggtgctgggcgacatc
gagctgttcgcccgcacggtgaacgccgcgcccgagcacaagaagcccaagatcatcgcc
atcaccggcaccaacggcaagtcgacgacgacggccctgatcggccatctgtgccgccag
gccgggcgcgacacccgggtcggcggcaatatcggcgagggcgtgctgggcctggaggac
atgcacggcggcgcggtctacgtgctggagctgtcgtcctaccaactggacctgacctcc
agcctcaagcccgacgccgtggtgctgctgaacatctcgcccgaccacctggaccggcat
ggcgggatggacggctatatcgccgccaagcgccggatcttcctcaaccagggcaagggc
gacacggcgatcatcggggtggacgatccctggtgccagcagatctgcaccgagatcacc
gccgccaaccgccgcaccatctggccgatcagcgccggcaaggccatggggcgcggcgtc
tacgccctgcagggcgtgctgtacgacgcgaccggcgagcgcgtgaccgagatggccgac
ctgttgcgggcccgcagcctgccaggccgtcataactggcagaacgccgcggccgcctac
gccgcggccaaggccatcggcattcccgcccaccaggccgtcgacggcctgatgagcttc
ccgggcctggcccatcgcatggagacggtcggcaagctgggcaaggtccgcttcgtcaac
gacagcaaggccaccaacgccgacgccgcccgccaggcgatgtcgagctatcccaagttc
tactggatcgcgggcggcgtgcccaaggccggcggcatagacgacctcgtcgacctgttc
ccgcgcgtggccggagcctatctgatcggccaggcggccgaggacttcggcaagacgctt
gagggcaaggccccggcgcgccagtgcggcgatatcgagaccgctgtcgccgccgcctat
gccgacgccgtcgccagcggggaggaggcggtcgtcctgctttcgccggcctgcgcctcg
ttcgaccagttcgccgacttcgagcagcgcggcgaggcgttccgcgcggcggtcaacgga
ttgggcaagccggcggcgaagcgggcctag

DBGET integrated database retrieval system