KEGG   Caulobacter sp. K31: Caul_3823Help
Entry
Caul_3823         CDS       T00651                                 

Definition
(GenBank) Lytic transglycosylase catalytic
Organism
cak  Caulobacter sp. K31
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT SLT_2 Transglycosylas
Motif
Other DBs
NCBI-ProteinID: ABZ72949
UniProt: B0SV59
Position
4141472..4142404
Genome map
AA seq 310 aa AA seqDB search
MRDPSTFARVTACAKFIPLFAGKPSHPSVPLDDQSAIARSEGQGRPSAGARALPLTEAST
VASCRRRGGGTPVHIAILLLVGISFTAIEPAAALAQNRSIERPSSPDPYADFIAEASQRF
GIPTAWIRAIMRVESANDVRAISPKGAMGLMQIMPATWADLRARHRLGDNPYDPRDNILA
GAAYLRELHDRYGSPGFLAAYNAGPGRYEEYVATGRALPAETRAYVAVLTPLVGDGATTG
PITVATVDPLAWVRAPLFIGRNERIAAADPVQPDRSSIDAPTAIPVRDPAAIAPQSDGLF
VARSERRGPQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgagacccaagcacgttcgcacgcgtgacggcctgcgcgaagttcatccctttgttc
gcgggaaagccgtctcatccctccgtcccgctcgacgaccagtcggccatcgcgcgcagc
gaaggtcaggggcggccatcggccggcgctcgcgccttgcccttgaccgaagcgagcacg
gtggcaagctgccgtcgtcgtggaggcggaacgccggttcatatcgcgatccttttgctg
gtcgggatctcgttcacggcgatcgagcccgccgccgcgcttgcacagaacaggtcgatc
gagcggccttcgtcccccgatccctatgccgacttcatcgccgaagcctcgcagcgcttc
ggcattccgacagcctggattcgcgccatcatgcgcgtcgaaagcgccaacgacgtgcgc
gctatctcgcccaaaggcgcgatgggattgatgcagatcatgcccgcgacctgggccgat
ctgcgcgcccgccatcggcttggcgacaatccgtatgatccgcgtgacaacatcctggcc
ggcgctgcctatcttcgtgaactgcacgatcgctacggatcgcccggcttcctcgccgcc
tacaatgcaggccccggccgctacgaggaatatgtcgcgaccggccgcgcgttgcccgcc
gagacccgcgcctatgtcgccgtcctcactccgcttgtcggcgatggcgcgacaactgga
ccgatcacggtggcgaccgtcgatccgctcgcctgggtccgtgcgccgctcttcatcggg
cgcaacgaacgcatcgcggccgccgatcctgtgcaaccggatcgttcgtcgattgacgct
ccaaccgccatcccggtgcgcgatcccgctgccatcgcgccgcagtccgatggcctgttc
gtcgcgcgatccgaacggcgaggaccgcaatga

DBGET integrated database retrieval system