KEGG   Caulobacter sp. K31: Caul_3830
Entry
Caul_3830         CDS       T00651                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
cak  Caulobacter sp. K31
Pathway
cak02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cak00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Caul_3830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cak02044]
    Caul_3830
Enzymes [BR:cak01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Caul_3830
Secretion system [BR:cak02044]
 Type IV secretion system
  Trb secretion system protein
   Caul_3830
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 AAA_10 TraG-D_C AAA_29 ABC_tran HerA_C AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: ABZ72956
UniProt: B0SV66
Position
4148667..4151123
AA seq 818 aa
MMNLAEYRRTATRLADFLPWVALVGDGVVLNKDGSFQRSARFRGPDLDSAVPAELVAVAG
RLNNAFRRLGSGWSIFVEAQRHAAATYPSSLFADSAAALVDTERKADFEEAGAHFESSYF
ITFLYLPPAEDAARAENWLYEGREQSGVDAREMMRGFVDRTDRVLQLVDGFMPECAWLDD
AETLTYLHSTVSTKRHRVRVPETPIYLDALLADQPLTGGLEPRLGTSHLRVLTIVGFPTA
TTPGILDELNRLAFPYRWSTRAILLDKTDATRLLTKIRRQWFSKRKSIAAILKEVMTNEA
SVLVDTDAANKAADADLALQELGADYAGQAYVTATVTVWDDDPRIAAEKLRLVEKVIQGR
DFTAIPETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPERDEHFGAPP
LLYGKTEGSTPFRFSIHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYAGSQVFAFDFGG
SIRAAALAMRGDWHDLGGFLTEGSDTSVSLQPLARIHEVQERAWAADWIVAILMREGVPI
TPDVKELIWTAMTSLASAPISERTITGLAVLLQSNDLKQALRPYCVGGPYGRLLDAEHEH
IGEASVQVFETEGLIGTDAAPAVLAYLFHRIEDRLDGRPTLLIVDEGWLALDDEGFAGQL
REWLKTLRKKNASVVFATQSLSDIDGSAIAPAIIESCQTRLLLPNERAIEPQITAIYRRF
GLNDRQIEILARATPKRDYYCQSRRGNRLFELGLSDVALALCAASSKQHQALIGDVLARS
GPDHFLEAWLAECSLGWATELIPELTNVIPQTDPEVRP
NT seq 2457 nt   +upstreamnt  +downstreamnt
atgatgaaccttgccgaataccgccgcaccgcaacccgtctcgccgatttcctgccctgg
gtagcgctcgtcggtgacggcgtcgtgctcaacaaggatggcagcttccagcggagcgcg
cggtttcgcggtccggacctcgatagcgccgtgccggccgagctggtcgccgtcgccggc
cgcctcaacaacgcttttcgtcgcctcggctctggctggtcgatcttcgtcgaagcacag
cgccacgccgctgccacctatccgtcgagcctgttcgccgacagcgcggccgcgctggtg
gataccgaacgcaaagccgacttcgaggaagccggcgcgcatttcgagtccagctacttc
atcaccttcctgtatctgccgccagccgaggacgccgcgcgcgccgagaactggctgtat
gaaggccgcgagcaatccggcgtcgatgcgcgcgagatgatgcggggctttgtcgatcgc
accgaccgcgtgctccagctcgtcgacggcttcatgcccgaatgcgcctggctcgatgac
gccgagacgctgacctacctgcattccaccgtctcgaccaaacgccaccgcgtccgggtg
cccgagacgccgatctatcttgacgcgttgctggccgatcagccgctgacaggcggcctc
gaaccccggctggggacatcgcatctgcgcgtgctgaccatcgtcggttttccgactgcg
acgacgcccggcattctcgatgagctgaaccggctggccttcccctatcgttggtcgaca
cgggcgatcctgctcgacaagaccgacgccaccaggttgctgaccaagatccgccggcaa
tggttttccaaacgcaagtcgatcgccgccatcctcaaggaggtgatgaccaacgaggcc
tctgtcctcgtcgacaccgacgccgccaacaaggcggccgatgccgatctcgcgcttcag
gagcttggcgccgactatgccggtcaggcctacgtcaccgccaccgtcacggtgtgggac
gacgatccgcgcatcgccgccgagaagctgcggctggtcgagaaggtcatccagggccgc
gacttcaccgcgatacccgagaccatcaatgccgtcgatgcctggctcggctcgctgccc
ggacacgtctacgccaatgtccggcaaccgccgatctcgacgctcaatctcgcccacatg
atcccgctctcagcggtgtgggcggggccggaacgggatgagcactttggtgcgcccccc
ttgctctacggcaagactgaagggtccaccccgttccggttttccatccatgtcggcgac
gtcggccatacgctcgtcgtcggcccgaccggcgccggcaagtcggtattgctggcgctg
atggcgctgcagttccggcgctatgccggaagccaagtcttcgcctttgacttcggaggc
tcgatccgcgccgccgcgctcgccatgcgtggtgactggcacgatctcggcggcttcttg
accgaggggtcggacacctccgtctcgcttcagccgctcgcccgcattcatgaggtgcag
gagcgcgcctgggccgccgactggatcgtcgccatcctgatgcgcgaaggcgtgccgatc
acccctgacgtcaaggagctgatctggacggcgatgacatcgcttgccagcgcgccgatc
tctgagcgcaccatcaccgggctcgccgtcctgctgcaatccaatgacctgaaacaggcg
ctgcggccctattgcgttggcggtccctatggccggctgcttgacgccgagcacgagcat
atcggcgaggcatcggtccaggtgttcgagaccgagggcctgatcggcaccgatgcggcg
ccggcggtgctcgcctatctctttcatcgcatcgaggaccgcctcgacggccggccgacg
ctgctgatcgtcgatgaaggctggctcgcgcttgatgacgagggttttgccggccagctc
cgcgagtggcttaagaccctgcgcaagaagaacgccagcgtcgtcttcgccacgcagtcg
ctctccgacatcgacggctcggccatcgcgccggcgatcatcgagagctgccagacgcga
ttgctgctccccaacgagcgagcgatcgaaccgcagatcaccgccatttaccgccgcttc
gggctcaacgatcgccagatcgagatcctcgcgcgggcgacgcccaagcgggattattac
tgccagtcacggcgcggcaatcgcctgttcgagctgggactgtccgacgtggcgctggcg
ctctgcgccgcttcctcgaaacagcaccaggcacttatcggcgacgtgcttgcccgctcc
ggcccggaccacttcctcgaagcgtggctggccgagtgctcgctcggctgggcgaccgag
ctgatccccgaactcaccaatgtcatcccccaaaccgatccggaggtacgtccatga

DBGET integrated database retrieval system