KEGG   Caulobacter sp. K31: Caul_4010Help
Entry
Caul_4010         CDS       T00651                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cak  Caulobacter sp. K31
Pathway
cak00071  Fatty acid degradation
cak00072  Synthesis and degradation of ketone bodies
cak00280  Valine, leucine and isoleucine degradation
cak00310  Lysine degradation
cak00362  Benzoate degradation
cak00380  Tryptophan metabolism
cak00620  Pyruvate metabolism
cak00630  Glyoxylate and dicarboxylate metabolism
cak00640  Propanoate metabolism
cak00650  Butanoate metabolism
cak00900  Terpenoid backbone biosynthesis
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01120  Microbial metabolism in diverse environments
cak01130  Biosynthesis of antibiotics
cak01200  Carbon metabolism
cak01212  Fatty acid metabolism
cak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Caul_4010
   00630 Glyoxylate and dicarboxylate metabolism
    Caul_4010
   00640 Propanoate metabolism
    Caul_4010
   00650 Butanoate metabolism
    Caul_4010
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Caul_4010
   00072 Synthesis and degradation of ketone bodies
    Caul_4010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Caul_4010
   00310 Lysine degradation
    Caul_4010
   00380 Tryptophan metabolism
    Caul_4010
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Caul_4010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Caul_4010
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Caul_4010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cak04147]
    Caul_4010
Enzymes [BR:cak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Caul_4010
Exosome [BR:cak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Caul_4010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABZ73135
UniProt: B0SWS7
Position
complement(4341201..4342373)
Genome map
AA seq 390 aa AA seqDB search
MREAVIVATARTPIGRAYRGAFNNTPSPTLAAHALTAAVARAGVAPDEIEDCLLGCSLPQ
GVQHTIGRMAALRAGFPATVPGMTMDRQCSSGLMTIATAAKQIIVDRMDMIVAGGVESIS
LVQTPDLRVDQDPGLVALYPDAYMPMLDTAEVVAARYGVTREACDLYSLASQYRAAAAQA
TGRFDAEIVPVTATMKVVDKQTQAVDFREVTLDRDEGVRPDTTFEGLSALKAVRPGGVVT
AGNASQLSDGASACVVMEAGLAARRGLQPLGRYVGMAVAGVAPDEMGIGPVFAIPRLLER
FDLSIDDIGLWELNEAFACQVLYCRDRLGIPDERLNVDGGAIAMGHPYGMSGARLVGHAL
LEGKRRGARHVVVTMCVGGGMGAAGLFEVL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggccgtcatcgtcgccacggcgcgcacgccgatcggccgcgcctatcgcggg
gccttcaacaacacgccgtcgccgaccctggcggcccatgccctgaccgccgccgtggcg
cgggccggggtcgcgccggacgagatcgaggactgcctgctgggctgctcgctgccgcag
ggcgtgcagcacacgatcggtcgcatggcggccctgcgcgcgggcttcccggccaccgta
ccgggcatgaccatggatcgccaatgctcgtcgggtctgatgaccatcgccaccgcggcc
aagcagatcatcgtcgaccgcatggacatgatcgtggccggcggggtggagtcgatctcg
ctggtccagacgccggacctgcgggtcgaccaggacccgggtctcgtggccctctacccc
gacgcctatatgccgatgctcgacaccgccgaggtggtcgccgcccgctatggcgtcacc
cgcgaggcgtgcgatctctattccctggcctcgcagtatcgcgccgccgccgcccaggcc
acgggacgcttcgacgccgagatcgtgccggtgaccgcgaccatgaaggtggtcgacaag
cagacccaggcggtcgacttccgcgaggtgacgctggaccgcgacgagggcgtgcgtccc
gacaccactttcgagggcctgtcggcgctgaaggccgtgcggcccggcggagtggtcacg
gccggcaacgccagccagctgtcggacggcgcctcggcctgcgtggtgatggaggccggc
ctggccgcccggcgcggcctgcagccgctgggccgctatgtcggcatggccgtcgccggc
gtggcgcccgacgagatgggcatcggcccggtcttcgccatcccgcgcctgctggagcgc
ttcgacctgtcgatcgacgacatcggcctgtgggagttgaacgaggccttcgcctgccag
gtgctctattgccgcgaccggctgggcattcccgacgagcgcctgaacgtcgacggcggc
gccatcgccatgggccacccctacgggatgtccggcgcccgcctggtcggccacgccctg
ctggaaggcaagcgccgcggcgcgcgccatgtcgtggtgaccatgtgcgtcggcggcggc
atgggcgcggcggggctgttcgaggtgctgtga

DBGET integrated database retrieval system