KEGG   Caulobacter sp. K31: Caul_4064Help
Entry
Caul_4064         CDS       T00651                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cak  Caulobacter sp. K31
Pathway
cak00790  Folate biosynthesis
cak01100  Metabolic pathways
Module
cak_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Caul_4064
Enzymes [BR:cak01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Caul_4064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABZ73189
UniProt: B0SWY1
Position
4400893..4401486
Genome map
AA seq 197 aa AA seqDB search
MSTPPPLAPKPPVPEDVQEAIRTLIRWTGEDPSREGLVDTPSRVARAWKEYCEGYGEDPA
QHLSRVFEEVGGYDDIVLLKDVPFQSHCEHHMAPIIGKAHIAYLPRDRVVGISKLARVLH
GFARRLQIQERLTAEIADCLWDNLQPLGVAVVIEASHACMSGRGVRTPGVTMKTSRMMGV
FRDDERSRREVLSLMGF
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccccgcccctcgcccccaagcccccggttcccgaggacgtccaggaggcc
atccgcaccctgatccgctggaccggcgaggatccgtcgcgcgaggggctggtcgacacc
ccgtcgcgggtggcgcgggcctggaaggaatattgcgagggctatggcgaggaccccgcc
cagcacctgtcgcgggtgttcgaggaggtcggcggctatgacgacatcgtgctgctcaag
gacgtcccgttccaatcgcattgcgagcaccacatggcgccgatcatcggcaaggcgcac
atcgcctacctgccgcgcgaccgggtggtggggatctccaagctggcgcgggtgctgcac
ggcttcgcccggcggctgcagatccaggagcgcctgaccgccgagatcgccgactgcctg
tgggacaacctccagcccctgggcgtggccgtggtcatcgaggccagccacgcctgcatg
agcggccgcggcgtgcgcacccctggcgtgacgatgaagaccagccggatgatgggcgtg
ttccgcgacgacgaacgctcccggcgcgaggtgctgtcgctgatgggcttctga

DBGET integrated database retrieval system