KEGG   Caulobacter sp. K31: Caul_4164
Entry
Caul_4164         CDS       T00651                                 

Definition
(GenBank) type I secretion membrane fusion protein, HlyD family
  KO
K11003  hemolysin D
Organism
cak  Caulobacter sp. K31
Pathway
cak03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cak00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Caul_4164
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cak02000]
    Caul_4164
   02044 Secretion system [BR:cak02044]
    Caul_4164
Transporters [BR:cak02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   Caul_4164
Secretion system [BR:cak02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   Caul_4164
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 HlyD Biotin_lipoyl_2 Biotin_lipoyl DUF2254
Other DBs
NCBI-ProteinID: ABZ73288
UniProt: B0SXS6
Position
complement(4528997..4530406)
AA seq 469 aa
MIAAALTQWGRHWDVLAESWRLQRAAERERSPRDETAFLPAALEVLETPPNPLGRIILWA
MLAFIAIALAWSILGKVDMVAAAPGKVIPRGNVKLIQAADYGVVRALHVVEGQSVRAGQP
LVDLDPTATGADVAQARQALLSADIDAARATALVDYAGGRSTAFRAPDGADRASVATQRA
FVDAKRREQAATLQGLQQDRRQRQGELGMIESEMVKLAQQIPLAEERLAGMRSLASKGYA
PRMKVSELEQTIVGMRQDLAIRRDERSKAQAAVAGVDQQIAKARGEFSREVLDALTEAQA
NRRLRGEELTKASDKAGLTVLTAPQDGVIQQMQVHTLGGVVKPADPLMVLVPKGGELIIE
ARVQNRDAGFVHEGQSVEIKLEAYPFTRYGVVHGVIEHIGRDAVQDEKEGLVFPAMVKLT
QPWISVEGRRVPLAPGLAATVEIKTGERRIIGFLLSPLARRVKEGGRER
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgatcgccgccgcgcttacccaatggggccgtcactgggacgtcctggccgagagctgg
cgcctgcagcgcgccgccgagcgcgagcgctcgccgcgcgacgagaccgccttcctgccc
gccgccctggaagtgctggagaccccgcccaaccctctgggccggatcatcctgtgggcg
atgctggccttcatcgccatcgccctggcctggtcgatcctgggcaaggtcgacatggtc
gccgccgcgcccggcaaggtcatcccgcgcggcaacgtcaagctgatccaggccgccgac
tacggcgtggtgcgggcgctgcacgtggtcgagggtcagagcgtgcgggctggtcagccg
ctggtcgatctcgaccccaccgccaccggggccgacgtcgcccaggcccgccaagccctg
ctcagcgccgacatcgacgcggctcgcgccacggccctggtcgactatgccggcggccgg
tccacggcgttccgcgccccagacggggccgaccgcgcctcggtcgccacccagcgggcc
ttcgtcgacgccaagcgccgcgaacaggccgccaccctgcagggcctgcaacaggaccgc
cgccagcgccagggcgagctgggcatgatcgagagcgaaatggtcaagctggcccagcag
atcccgctagcggaagagcgcctggcgggcatgcgcagcctggcgtccaagggctatgcg
ccgcgcatgaaggtctcggagctggagcagaccattgtcgggatgcgccaggacctggcc
atccggcgcgacgagcgctcgaaggcgcaggccgccgtggccggggtcgaccagcagatc
gccaaggcccgcggcgagttctcgcgcgaggtgctcgacgccctgaccgaggctcaggcc
aaccgccggctgcgcggcgaggagctgaccaaggccagcgacaaggcgggccttaccgtg
ctgaccgcgccgcaggacggggtgatccagcagatgcaggtccacaccctgggcggggtg
gtcaagccggccgatccgctgatggtgctggtgcccaagggcggcgagttgatcatcgag
gcccgcgtccagaaccgcgacgccgggttcgtccacgaaggccagagcgtcgagatcaag
ctcgaggcctatcccttcacccgctacggtgttgtccatggggtgatcgaacacatcggc
cgcgacgccgtgcaggacgaaaaggaaggccttgtctttccggcaatggttaagctcacg
caaccatggatcagtgtcgaaggccggcgcgtgccgctggccccgggcctggcggccacg
gttgagatcaagaccggcgaacgccggatcatcgggttcctgctgtcgcctttggcgcgt
cgggttaaggaaggcgggagggaacgatga

DBGET integrated database retrieval system