KEGG   Caulobacter sp. K31: Caul_4351Help
Entry
Caul_4351         CDS       T00651                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
cak  Caulobacter sp. K31
Pathway
cak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cak00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Caul_4351
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cak02022]
    Caul_4351
Two-component system [BR:cak02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Caul_4351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF2884
Motif
Other DBs
NCBI-ProteinID: ABZ73471
UniProt: B0SZE2
Position
4726789..4727490
Genome map
AA seq 233 aa AA seqDB search
MTPEERAERHLLVVDDDDRIRTLLKEFLSRAGFRVSAAADAAHADRLTGAMDFDLLVLDV
MMPGEDGFSFTKRLRARGGEAGRTPILMLTARDQTGDRIEGLTHGADDYLAKPFEPRELL
LRIEAILRRTAPKPSGPRALSLGACAFEPERGELTRDGEPIRLTEAEVALLRRLARAAHA
PVDRLELARDTVDATGRAVDVQVTRLRRKIEPDPKNPRYLQTVRGIGYRLAPD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaagagcgggccgagcgccacctgctggtggtcgatgacgacgaccgcatc
cgcaccctgctcaaggaattcctcagccgcgccggcttccgggtcagcgccgccgccgac
gccgcccacgccgaccggctgacgggggcgatggacttcgacctgctggtgctggacgtg
atgatgcccggcgaggacggcttctcgttcaccaagcgcctgcgggccaggggcggcgag
gccggcaggacgccgattctgatgctgaccgcccgcgaccagaccggcgaccgcatcgag
ggcctgacccacggcgccgacgactacctggccaagccgttcgagccccgggagctgctg
ctgcgcatcgaggcgatcctgcgccgcaccgcgcccaagccctcgggtccgcgcgccctc
agcctgggggcctgcgccttcgagcccgagcgcggcgagctgacccgcgacggcgaaccg
atccgcctgaccgaggccgaggtcgccctgttgcgccgcctggcccgggcggctcatgcg
ccggtcgaccgcctggaactggcccgcgacaccgtcgacgccaccggccgcgccgtcgac
gtccaggtcacccgcctgcgccgcaagatcgaaccggacccgaagaacccccgctatctg
cagaccgtgcgcgggatcggttatcggctggcgccggattga

DBGET integrated database retrieval system