KEGG   Caulobacter sp. K31: Caul_4389Help
Entry
Caul_4389         CDS       T00651                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
cak  Caulobacter sp. K31
Pathway
cak00970  Aminoacyl-tRNA biosynthesis
Module
cak_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cak00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Caul_4389
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cak01007]
    Caul_4389
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cak03016]
    Caul_4389
   03029 Mitochondrial biogenesis [BR:cak03029]
    Caul_4389
Enzymes [BR:cak01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Caul_4389
Amino acid related enzymes [BR:cak01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Caul_4389
Transfer RNA biogenesis [BR:cak03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Caul_4389
 Prokaryotic Type
   Other AARSs
    Caul_4389
Mitochondrial biogenesis [BR:cak03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Caul_4389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N
Motif
Other DBs
NCBI-ProteinID: ABZ73509
UniProt: B0T019
Position
complement(4763514..4765355)
Genome map
AA seq 613 aa AA seqDB search
MSDLKRSLSEAAAAAFQAAGLSPDFGRVTASDRPDLADFQCNGALAAAKSAKRNPREIAV
QVVDVLKADPRLASVEIAGVGFINMRVSTDALSIRANEIAADPRAGAEPLAHPRRVLVDY
AGPNVAKPMHVGHLRASIIGESVKRLYRFRGDDVVGDAHFGDWGFQMGLLISAIMEEDAF
IRALLERLVEAPREFSKADEDKVMSEFAQRVTLDDLDRLYPAASARQKEDPEFKEKARKA
TAELQNGRFGYRLLWRHFVNISRVALEREFHALGVDFDLWKGESDVQDLIAPMVRQLEVK
GLLVDDQGARIVRVARPGETKKKKLPDGSVVEVESPDPLLVVSSEGSAMYGTTDLATILD
RRKSFDPHLILYCVDQRQADHFEQVFRAAYLAGYAEPGSLEHIGFGTMNGSDGKPFKTRA
GGVLKLHDLIEMAREKARERLREAGLGAELSQEAFEETAHKVGIAALKFADLQNFRGTSY
VFDLDRFTSFEGKTGPYLLYQSVRIKSILRKAAEQKVVSGAIIVGEPAERDLTLLLDAFE
GALSEAYDKKAPNFIAEHAYKLAQTFSKFYAACPILSADNDATRASRLALAETTLKQLEL
ALDLLGIEAPERM
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttgaagcggtccctgagcgaggcggccgcggccgccttccaggccgccgga
ctgtcccccgacttcggtcgcgtcaccgcgtccgaccggcccgacctggccgatttccag
tgcaacggggccctggcggcagccaagagcgccaagcgcaatccgcgcgagatcgccgtc
caggtggtcgacgtcctgaaggccgacccgcgcctggcctcggtcgagatcgccggcgtc
ggcttcatcaacatgcgcgtcagcaccgacgccctgtcgatccgcgccaacgagatcgcc
gccgacccgcgcgccggggccgagcccctggcccatccgcgccgcgtgctggtcgactat
gccggccccaacgtcgccaagccgatgcacgtgggccacctgcgcgcctcgatcatcggc
gagtcggtcaagcgcctgtaccgcttccgcggcgacgacgttgtgggcgacgcccatttc
ggcgactggggcttccagatgggcctgctgatcagcgccatcatggaggaggacgccttc
atccgcgccctgctcgagcgcctggtcgaggccccgcgcgagttctccaaggccgacgag
gacaaggtcatgtccgagtttgctcagcgcgtcaccctggacgacctcgaccgcctctat
ccggcagcctcggcgcgccagaaggaagaccccgagttcaaggaaaaggcccgcaaggcc
accgccgaactgcagaacggccgcttcggctaccgcctgctgtggcgtcacttcgtcaac
atcagccgcgtggccctggagcgcgagttccatgccctgggcgtcgatttcgacctctgg
aagggcgagagcgacgtgcaggacctgatcgccccgatggtccgccagctcgaggtcaag
ggcctgctggtcgacgaccagggcgcccgcatcgtccgcgtggcccgtcccggcgagacg
aagaagaagaagctgcccgacggctcggtggtcgaggtcgaaagtcccgacccgctgctg
gtggtgtcgtcggaaggttcggccatgtacggcacgaccgacctggcgacgatcctggat
cgccgcaagtcgttcgacccgcacctgatcctctattgcgtggaccagcgccaggccgac
cacttcgagcaggtgttccgcgccgcctatctggccggctacgccgagcccggcagcctg
gagcacatcggcttcggcaccatgaacggcagcgacggcaagccgttcaagacccgggcc
ggcggcgtcctgaagctgcacgacctgatcgagatggcccgcgagaaggcccgcgagcgc
ctgcgcgaagctggcctcggggccgagctttcgcaagaggccttcgaggagaccgcccac
aaggtggggatcgcggccctgaagttcgcggacctgcagaacttccgtggcacctcctac
gtcttcgacctcgaccgtttcacaagcttcgagggcaagaccgggccgtacctgctgtac
cagtcggtgcgcatcaagagcatcctgcgcaaggcggccgagcagaaggtcgtgtcgggc
gcgatcatcgtcggcgagccggccgagcgcgacctgacgctgctgttggacgcgttcgaa
ggcgccttgagcgaggcctacgacaagaaggcccccaacttcatcgccgagcacgcctac
aagctggcgcagaccttctcgaagttctacgccgcttgcccgatcctcagcgccgacaat
gacgccacccgggcctcgcgcctcgccctggccgagacgacgttgaagcagctggagctg
gctttggatctgctgggcatcgaagcgccggaacggatgtag

DBGET integrated database retrieval system