KEGG   Caulobacter sp. K31: Caul_4421Help
Entry
Caul_4421         CDS       T00651                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
cak  Caulobacter sp. K31
Pathway
cak00790  Folate biosynthesis
cak01100  Metabolic pathways
Module
cak_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Caul_4421
Enzymes [BR:cak01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Caul_4421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CAT_RBD
Motif
Other DBs
NCBI-ProteinID: ABZ73541
UniProt: B0T051
Position
complement(4789420..4790199)
Genome map
AA seq 259 aa AA seqDB search
MGIVNVTPDSFSDGGCFLDPAAALAQARRLIADGADILDIGGESTRPGAAPVPVDQEIAR
VVPLIAAIRATSDVAISIDTMKPAVARAAVAAGATIWNDVAALRFAPDAPEGAAELGCEV
VLMHMLGEPGTMQDDPRYDDVVAEVEAFLLARALTAMAAGVEREKIWLDPGIGFGKTPAH
NVALLAALPRFVALGYPVLLGASRKRFIAALDPLGAEADARLGGSLAAHLHGAAAGVAAV
RAHDVRETVQALTVWAAIA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcgttaatgtcacgcccgacagcttctcggacggcgggtgctttctcgacccc
gcggcggccctggcccaggcccggcggctgatcgccgacggggccgatatcctcgacatc
ggcggcgagagcacaaggcccggcgccgcccccgtgcccgtcgaccaggagatcgcccgc
gtcgtcccgctgatcgcggcgatccgcgccaccagcgacgtggcgatctcgatcgacacc
atgaagcccgccgtggctcgcgccgccgtcgcggccggcgccacgatctggaacgacgtc
gcagccctgcgcttcgctcctgatgccccggagggcgccgccgagctgggctgcgaggtg
gtgctgatgcacatgctgggtgagccggggaccatgcaggacgacccgcgttacgatgat
gtggtcgccgaggtcgaggccttcctgctggcccgggccctgaccgccatggccgctggg
gtcgagcgcgagaagatatggctggatccgggcatcggcttcggcaagacccctgcgcac
aacgtcgccctgctggccgccctgccgcgcttcgtggccctgggctatccggtgctgctg
ggcgccagccgcaagcggttcatcgccgcgttggatccgctgggcgcggaggccgacgcg
cggctgggcggctcgctggcggcccacctgcacggcgcggcggcgggcgtggcggcggtg
cgggcgcacgacgtcagagagacagtccaggcgctcacggtgtgggcggcgatcgcctag

DBGET integrated database retrieval system