KEGG   Caulobacter sp. K31: Caul_4465Help
Entry
Caul_4465         CDS       T00651                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cak  Caulobacter sp. K31
Pathway
cak00071  Fatty acid degradation
cak00280  Valine, leucine and isoleucine degradation
cak00281  Geraniol degradation
cak00310  Lysine degradation
cak00360  Phenylalanine metabolism
cak00362  Benzoate degradation
cak00380  Tryptophan metabolism
cak00410  beta-Alanine metabolism
cak00627  Aminobenzoate degradation
cak00640  Propanoate metabolism
cak00650  Butanoate metabolism
cak00903  Limonene and pinene degradation
cak00930  Caprolactam degradation
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01120  Microbial metabolism in diverse environments
cak01130  Biosynthesis of antibiotics
cak01212  Fatty acid metabolism
Module
cak_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Caul_4465
   00650 Butanoate metabolism
    Caul_4465
  Lipid metabolism
   00071 Fatty acid degradation
    Caul_4465
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Caul_4465
   00310 Lysine degradation
    Caul_4465
   00360 Phenylalanine metabolism
    Caul_4465
   00380 Tryptophan metabolism
    Caul_4465
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Caul_4465
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Caul_4465
   00281 Geraniol degradation
    Caul_4465
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Caul_4465
   00627 Aminobenzoate degradation
    Caul_4465
   00930 Caprolactam degradation
    Caul_4465
Enzymes [BR:cak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Caul_4465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABZ73585
UniProt: B0T095
Position
4839795..4840553
Genome map
AA seq 252 aa AA seqDB search
MEVELTTDGPVWTVTINRPEKRNAVNPDTALQLRAAFDAFEADPEAAVAVLTGAGGTFCA
GFDLAVAASGEAERYDPVGEGPMGPTRRLLSKPVIAAVEGHAVAGGLELALWCDLRVASE
SAIFGVFCRRWGVPLIDGGTVRLPRIVGQGRALDMILTGRAVDAAEALGWGLADRVVPTG
QALAAAQGLAAQIAAFPQTCLRADRASTFAQWDVSLEEALKVEGIGGLEPLRREARAGAA
RFKDGEGRGGKF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcgaactgaccacggacggcccggtctggaccgtcacgatcaatcgtcccgaa
aagcgcaacgcggtgaaccccgacaccgccttgcaattgcgcgccgccttcgacgccttc
gaggccgatccggaggccgccgtcgccgtgctgaccggggcgggcgggacgttctgcgcc
gggttcgacctggcggtggcggcctcgggcgaggccgagcgctacgatccggttggcgag
ggtccgatgggaccgacgcggcggctgttgtccaagccggtgatcgccgccgtcgagggc
cacgccgtggccggcgggctggagctggctttgtggtgcgacctgcgggtggcctcggaa
agcgcgatcttcggggtgttctgccggcgctggggcgtgccgctgatcgacggcggcacg
gtgcggctgccgcgcattgtcggccagggccgggcgctggacatgatcctcaccggccgc
gccgtggacgccgccgaggcgctgggctggggcctggccgaccgtgtggttccgacgggc
caggcgcttgccgccgcgcaaggcctggccgcccagatcgccgccttcccgcagacctgc
ctgcgcgccgaccgcgcctcgaccttcgcgcaatgggacgtctcgctggaggaggcgctg
aaggtggaggggatcggcgggctggagcccctgcgccgcgaagcgcgggccggggcggcg
cgattcaaggatggcgaggggcgcggggggaagttttag

DBGET integrated database retrieval system