KEGG   Caulobacter sp. K31: Caul_5330
Entry
Caul_5330         CDS       T00651                                 
Name
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
cak  Caulobacter sp. K31
Pathway
cak02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cak00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Caul_5330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cak02044]
    Caul_5330
Enzymes [BR:cak01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Caul_5330
Secretion system [BR:cak02044]
 Type IV secretion system
  Trb secretion system protein
   Caul_5330
SSDB
Motif
Pfam: T2SSE AAA_16 DEAD Mg_chelatase FtsK_SpoIIIE ResIII ABC_tran AAA_30 Zeta_toxin AAA_29 TrwB_AAD_bind Sigma54_activat AAA_22 AAA_23 ABC_ATPase AAA_10 AIG1 AAA_33 IstB_IS21 AAA_7 AAA_28 RuvB_N AAA_19 DUF87 NACHT MMR_HSR1 RsgA_GTPase Sigma54_activ_2 TsaE Dynamin_N cobW AAA_18 PhoH PduV-EutP ATPase P-loop_TraG AAA AAA_24 NB-ARC SRP54 DUF2075 Septin SWI2_SNF2 TIP49 G-alpha CbiA DUF815 UvrD-helicase AAA_8
Other DBs
NCBI-ProteinID: ABZ74449
UniProt: B0T9Q0
Position
pCAUL02:complement(39121..40083)
AA seq 320 aa
MPQHHPVVTDRKVAALKQAMGPVIASALADRMVVEVMVNPDGKIWVDRIGEGRSFTGQSL
ASADADRILRLLADHVGEVVTRDRPRVSATLPETGERFQGAFMPIVSSPAFAIRKRPEVV
FTLPEYVDQGIMTEHQAQVIRAAATGRQNILIVGGTGSGKTTLANAILAEPAFAQDRVVL
IEDTAELQCSAEDKIQMLTKRTDPPVTMTDLVRDTLRLRPDRIIIGEVRDGSALDLLKAW
NTGHPGGLATIHANSALEGLTRLEDLIGEVTHRIPYRAITQAINVIVYIERTAMGRRVRE
VSRLTGREGDGYILETGVEP
NT seq 963 nt   +upstreamnt  +downstreamnt
atgccgcagcaccaccccgtcgtcaccgaccgcaaggtcgccgcgctgaagcaggctatg
ggcccggtgatcgccagcgcgctcgccgaccgcatggtagtggaggtcatggtcaacccg
gatggcaagatctgggtggaccggatcggggaggggaggtcgttcaccggccagagcctg
gccagcgccgacgctgatcggatcctgcggctgctggccgatcatgtgggcgaggtggtc
acccgagaccggcctcgggtcagcgccacgcttccggagaccggggagcggttccaaggc
gccttcatgcccatcgtatccagccccgcgttcgcgatccgcaagcggccagaggtggtg
ttcaccctgccagaatatgtggaccaggggatcatgaccgagcaccaggcgcaggtgatc
cgcgcggcggcgacggggcgtcagaacatcctgatcgttggcggtacgggctcgggcaag
acaacgctcgctaacgccatcctggcggagccggcctttgcccaggaccgcgtggtgctg
atcgaggacaccgctgagctccagtgctcggccgaggataagatccagatgctgaccaag
cggacggacccgccggtgaccatgaccgacttggtgcgcgacaccctgcgtctgcggcct
gaccgcatcatcatcggggaggtgcgggatgggtcagcgctggatctcttgaaggcgtgg
aatacgggccatccgggcggtctggcgaccatccacgccaacagcgccttagagggactg
acgcgcctggaagacctgatcggggaggtgacccaccggataccctatcgggcgatcact
caggcgatcaacgtcatcgtctacatcgagcggacggcgatgggacggcgggtcagggag
gtgagccgcctgacggggcgcgagggggacggctatatcttggaaaccggcgttgagccc
taa

DBGET integrated database retrieval system