KEGG   Caulobacter sp. K31: Caul_5331
Entry
Caul_5331         CDS       T00651                                 
Name
(GenBank) TRAG family protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
cak  Caulobacter sp. K31
Pathway
cak03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cak00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Caul_5331
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cak02044]
    Caul_5331
Enzymes [BR:cak01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Caul_5331
Secretion system [BR:cak02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Caul_5331
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: ABZ74450
UniProt: B0T9Q1
Position
pCAUL02:complement(40137..42113)
AA seq 658 aa
MSARPKIILPLAAASVLIALSIATQIVAHDFHYPREFGHGLLDVGQARIYAPWAFIGWYG
RFAARYQQAFDMAAMIALAAVFVPSMLLIGLTKSTRRAPREFGKDAWATEAHVRKAKLVH
GDGQISGRVLGRFNGKYLTYRGVEHAIIVGASRSGKGAGHVVPTLIAWPQSAFVYDRKGE
LWHITADHRKTFSHVFYFAPTDPNTVRWNPLFEVRKGPMEIADIQNVVGILVDPLGRKAG
DLNFWDQSATDFFTAIILHVLYSEEDTKKNLAQVRRLLINIDPTLHAMKHTKHRHRPDLH
APGGLARGADGKPIAEVHPEILLGATALDSMDERVKSNVLATCRASLSLWADPYVEYATS
WSDFSIGDLVCSESPVTFYIITPQAHADRLAFLVRVFTRQTINSLMEREHFDSRGRRKAH
RLLLLLDEFPKLGSLPFLENAMGEMAGYGITAHLICQSFNDVFSKYGDKTPIFDNMHITA
TFATSEPTSIDKVIRRAGKALEMRESYSDPRSIFGSSHRSTSQSEHERYILTEDRVRELD
DDQQFLFVNNTKPIRAEKIRYYDEPFFKARTGDYFHGVPAKYEQRPGTADLPGPAQIDWL
GVRAAEPAPAGLKGVVPPPAPEETDDGPQPAGDSGQGLHAPVSSLRWTGDDDDDGSLG
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgagcgcccgccccaagatcatcctgccgctagcagcggccagcgtgttgattgcccta
tcgatcgccactcagatcgtcgctcacgacttccactacccgcgtgagttcggccacggc
ctgctggatgtggggcaggcgaggatctacgcgccgtgggcgttcattggctggtatggg
cgcttcgcggcgcgctaccagcaggccttcgacatggcggcgatgatcgcgctcgcggcc
gtgttcgtcccgtcgatgttgctgatcgggctgaccaagagcacgcgccgggcgccgcga
gagtttggcaaggacgcctgggcgaccgaggcccatgtccgcaaggccaagctcgtccat
ggtgacggccagatcagcggacgggtgctcggccggttcaacggcaaatacctcacctat
cgcggtgtggagcacgccatcatcgtgggcgcgtcccgcagcgggaagggggccggccac
gtcgttcccaccctgatcgcctggccgcaaagcgccttcgtctacgaccgcaaaggggag
ctttggcacatcacggccgatcaccggaagaccttcagccacgtcttctatttcgcgccg
accgaccccaacaccgtgcgatggaatccgctgttcgaggtgcggaaggggccgatggag
atcgccgacatccagaacgtcgtcggcatcctggtggacccgctgggccgaaaggcgggc
gacctcaatttctgggaccagagcgcgacggacttcttcaccgcgatcatcctgcacgtc
ctctacagcgaggaggacaccaagaagaacctcgcccaggtccgccgcctgctgatcaat
atcgatccgacccttcatgcgatgaagcacaccaaacatcgccacagaccggaccttcat
gcgccgggcgggctggcgcggggcgccgacggcaagcccatcgccgaggtccacccggag
atcctgctgggcgccacggcgctggacagcatggacgagcgggtgaagtccaatgtgctg
gccacctgtcgggcgtcgctatcgctgtgggccgacccctacgtggaatacgccaccagc
tggtcggacttctcgatcggcgacctggtgtgctcggagagcccggtcaccttttacatc
atcaccccccaggcccatgccgaccgcctcgcctttctggtgcgggtgttcacgcgccaa
acgatcaacagcctgatggaacgcgagcatttcgacagccgggggcggcgcaaggcgcat
cgactgctgctgctgctcgacgagtttcccaaacttggcagcctgcccttcctggaaaac
gccatgggcgaaatggccggctacggcatcaccgcccacctgatctgccagagcttcaac
gacgtgttctccaagtacggggacaagacgccgatcttcgacaacatgcacatcaccgcc
accttcgcgacctcggagcctacgagcatcgacaaggtgatccggcgcgccggcaaggcg
ctggagatgcgcgagagctacagcgatccgcgcagcatcttcggcagctcgcaccgctcg
acctcccagagtgagcacgagcgctacatcctgaccgaggaccgggtccgcgagctggac
gacgaccagcagttcctgttcgtgaacaacaccaagccgatccgggcggagaagatccgc
tactacgacgagccgttcttcaaggcgcggacgggggactatttccacggcgtgcccgcc
aagtacgagcagcggccgggtacggctgacctgccagggcccgctcagatcgactggctt
ggggttcgcgcggcagagccggccccggccggcctgaagggtgtcgtgccgccgcctgcg
cccgaagagacggatgatggacctcagcccgccggcgacagcgggcagggcctccacgcc
ccggtctcgagcctgcgatggactggcgacgacgatgacgacggcagccttggctga

DBGET integrated database retrieval system