KEGG   Caulobacter sp. K31: Caul_5335
Entry
Caul_5335         CDS       T00651                                 

Definition
(GenBank) conjugal transfer protein TraF
Organism
cak  Caulobacter sp. K31
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ABZ74454
UniProt: B0T9Q5
Position
pCAUL02:complement(45469..46008)
AA seq 179 aa
MIHGLVRRRLLVIAAALAPAVLLGALALVVQGPSLLWNRSDSEPRGLYIRSAAAPSRGQI
IAFPAPPSVLTYASGRMAYMRHMPILKEVAAMSGDTVCTLDGKLVINGVWRAPVLAHDGE
SRPLPHWRACRRLGEGEFFVFSNRIPNSFDSRYYGPVRHEAIVGVFRPIMTQADRPGDV
NT seq 540 nt   +upstreamnt  +downstreamnt
atgatccatggccttgtgagacgcaggctcctggttatcgcggcggcattggctccggcc
gtgctgctgggcgccctggccctggtcgttcagggcccgtcgctgctgtggaatcgctcg
gatagtgagcccaggggcctctacattcgcagcgctgcggctccaagccggggccagatc
atcgcgttcccagccccgccctcggtcctgacctacgccagcggtcgcatggcctatatg
cgccatatgccgatcctaaaggaggtcgcggcgatgtcgggagacaccgtctgcaccctc
gacggcaagctggtgatcaacggcgtgtggcgcgcgcccgtgctcgcccatgacggcgag
agccggccgctaccgcactggcgcgcctgccgccgtctgggcgagggcgagttctttgtg
ttctccaaccgcatccccaacagcttcgacagccggtactacggaccggttcggcacgag
gcgatcgtcggcgtcttccgcccgatcatgacccaggccgaccgcccaggtgacgtctga

DBGET integrated database retrieval system