KEGG   Caulobacter sp. K31: Caul_5367
Entry
Caul_5367         CDS       T00651                                 
Name
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
cak  Caulobacter sp. K31
Pathway
cak02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cak00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Caul_5367
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cak02044]
    Caul_5367
Secretion system [BR:cak02044]
 Type IV secretion system
  Trb secretion system protein
   Caul_5367
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ABZ74486
UniProt: B0T9T7
Position
pCAUL02:complement(77675..78931)
AA seq 418 aa
MRHLPPDPPLDGRPSYEPERKASSASVLSAPRFPVTRWNRKYLMAGAAVLASIVAGGFYL
GFGGAHATKGRPDDSQNAADTSSPQTPEIATRYAAGYADPAVRPGTTSLPPPDALAPPAP
TTQAAGQPGQPAPVDPAVQAAREQALAARSASPFFGGAQAQPQAASQTGPLAPDPGPMLA
AALVPGFGTPPASAAGDVQPANGQAGKRQFAAGARVDDYLTSPLQAPISPWEVKAGTIIS
AALITAINSDLPGQVIAQVTEPVYDHRTGRTVLIPQGSRLIGQYDSQVAHGQSRSLIAWN
RVIMPDGRSINIGSMAGADLSGAAGLQDKTDGHFWQLARGVALSTVFSVGAAAAQDAGTR
SSGGLVINSAGSGISTSAQQVGQQVTARDLNRQATLRIRAGWPLRVIVNKDMILAPYP
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgcgccatctccccccagatccgccgcttgatgggcggccgtcttacgagcccgaacgc
aaggccagctcggcgagcgtgctcagcgcacccaggttcccggtcacccgctggaaccgc
aagtatctgatggccggagccgccgtcctggccagcatcgtggccggcggattctacctg
ggctttggcggggcgcacgccaccaagggccggcccgacgattcgcagaacgccgctgac
acatcgagcccgcagacgccggagatcgccacccgctatgctgctggctacgccgatccg
gcggtgcggccgggcacgaccagcttgccgccgccggacgcgcttgcgccccctgccccg
acgacgcaggccgctggccagcccggccaaccggcgccggttgatcccgccgttcaggcg
gcgcgcgagcaggcgctggccgctcgctcggccagcccgttcttcggcggcgcccaggct
cagccgcaggccgcctcccaaactggccctttggcccccgatccggggccgatgctggca
gcggccctggtgcctggcttcggcacgccgcccgcgtcggcggccggcgacgtgcagccg
gccaatggccaggccggcaagcgtcagttcgcggccggcgccagggtcgatgactatcta
acgagccccctgcaggcgccgatcagtccttgggaggtcaaggccggcacgatcatctcg
gccgccctgatcacggcgatcaattccgatctgccgggccaggtgatcgcccaagtcacc
gagccagtgtacgaccacaggaccgggcgcacggtgctcatccctcagggctcgcggctg
atcggccaatacgacagccaggtcgcccacggccaaagccgctcgctgatcgcctggaac
cgggtgatcatgcccgacggccgttcgatcaacatcggctcgatggccggcgccgatctc
tccggcgcggccgggctgcaggacaagaccgatggtcacttctggcaactggctcgcggc
gtggcgctctcgacggtgttctccgtcggcgcggcggcggcgcaagacgccggaacccgc
agctccggcggtcttgtgatcaacagcgccggcagcgggatttccacttccgcccagcag
gtcggccagcaggtcaccgctcgcgacctcaaccggcaggccaccttgcggatccgggcc
gggtggccgctccgggtcatcgtcaacaaagacatgatcctggccccctacccctaa

DBGET integrated database retrieval system