KEGG   Caulobacter sp. K31: Caul_5371
Entry
Caul_5371         CDS       T00651                                 
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
cak  Caulobacter sp. K31
Pathway
cak02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cak00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Caul_5371
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cak02044]
    Caul_5371
Secretion system [BR:cak02044]
 Type IV secretion system
  Trb secretion system protein
   Caul_5371
SSDB
Motif
Pfam: AATF-Che1 DUF4141 Lact-deh-memb DUF5333 Fib_alpha T4SS DUF1664
Other DBs
NCBI-ProteinID: ABZ74490
UniProt: B0T9U1
Position
pCAUL02:complement(82220..82942)
AA seq 240 aa
MVKLLSTTAAIAALAMGMSAATPPPARAQMTVIDPAAIAQMTSQVANSLRQIEQLQSQIT
NQVAMLQKLGTDVTQPLTQINQQATQLLQQAQAIGYNSQNIAQQFQQLYPSDMTGQSFAQ
IRQRLASWESNSRLTMQDSMAAQNQLVRSQATTAGAVDSAVAASQGAAGQTAAVQATNQL
LAALSTQLQGLQTILIAQARTQDTILAQQQAGAIAARAETARATAFTKKGSSLPNITDFK
NT seq 723 nt   +upstreamnt  +downstreamnt
atggtaaagttgttgtcgacgacggccgcgatcgcggccttggcgatggggatgtccgcc
gcgacgcccccgcccgcgcgcgcgcagatgacggtcatcgatccggccgccatcgcccag
atgacctcccaggtcgccaacagcctgcgccagatcgagcagctccagtctcagatcacc
aaccaagtggcgatgctgcagaagctggggaccgacgtcacccagccgctgacacagatc
aatcagcaggccacccagctgctccagcaggcccaggctattggctacaatagccagaac
atcgcccagcagttccagcagctctacccgtcggacatgaccggccagagcttcgctcag
atccgacagcggcttgccagctgggagagcaacagccgcctgaccatgcaggattcgatg
gcggcccagaaccaactggtccggtcgcaggcgacgaccgccggcgccgtggacagtgcg
gtcgccgcgtcgcagggcgccgccggacagacggccgccgttcaggccaccaatcagctt
ctggcggccttgagcactcagttgcagggcctgcagaccatcctcatcgctcaggcgcgc
acccaggacaccattctggcccagcagcaggccggcgccatcgcggctcgggcggagacc
gcaagagcgactgcgttcaccaaaaagggcagctcgctccccaacatcacggatttcaaa
tga

DBGET integrated database retrieval system