KEGG   Caulobacter sp. K31: Caul_5373
Entry
Caul_5373         CDS       T00651                                 
Name
(GenBank) type IV secretory pathway VirB3 family protein
  KO
K20529  type IV secretion system protein TrbD
Organism
cak  Caulobacter sp. K31
Pathway
cak02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cak00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Caul_5373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cak02044]
    Caul_5373
Secretion system [BR:cak02044]
 Type IV secretion system
  Trb secretion system protein
   Caul_5373
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ABZ74492
UniProt: B0T9U3
Position
pCAUL02:complement(85872..86138)
AA seq 88 aa
MAQSQVEGFEIAFHSSLSEPVTIAGVPRMIAVLNGTLTAVLALGLQVPLIGIPFGLAIHG
ACYWLAKRDPYFFDALGRHIRQRPYLDA
NT seq 267 nt   +upstreamnt  +downstreamnt
atggcgcagtcgcaagtcgagggcttcgagatcgccttccacagctccctttcggagccg
gtcacgatcgccggcgtgccgcgaatgatcgccgtgctgaacggcacgcttacggcggtc
ctggcgctgggcctccaggtccccttgatcggcatcccattcggcctagccatccacggc
gcctgctactggctggccaagcgcgacccttacttcttcgacgccctcgggcggcacatc
cgccaacggccctacctggacgcctga

DBGET integrated database retrieval system