KEGG   Candida albicans: CAALFM_C202880CAHelp
Entry
CAALFM_C202880CA  CDS       T00189                                 

Gene name
EBP7, CaO19.5816
Definition
(RefSeq) Ebp7p
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
cal  Candida albicans
Brite
KEGG Orthology (KO) [BR:cal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CAALFM_C202880CA (EBP7)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     CAALFM_C202880CA (EBP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxidored_FMN AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 3642971
NCBI-ProteinID: XP_715357
UniProt: Q5A0J5
Position
2
AA seq 392 aa AA seqDB search
MTISNSNLFKPIKVGNKTIKNRIAHLPTTRNRATDDHVPTDLMKKYYTDRAKSGSLLITE
ATLISLDQGVYPNVPGMWNKQQKDAWKEITDSVHSIGGTIAIQLWALGRVGNAKLLKDEG
LPLTGVSPIYEHEKAEQDAIDAGNPIQELTQDQIKDIVYNQFANAVKLADEAGFDFIELH
GANSYLFEQFIHPGTNKRTDKYGGSIENRARFLFEVVDHVSTIVDPAKLAIRLSPLNNFQ
VPFVNPEGQEDYSYIVEGLQKRADEGKGLAFIDVVEGRFTSDGGTEGCNVDFVGEIWKGP
LLKGGNYTYDRKNEWKTIENDANADDRTLVGFGRYFIANPDLPARIQKGNELNDYDRSTF
YNTDDYGYNTYPFYGEENKADPNIKVLGVALA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctccaattcaaatttattcaaaccaattaaagtcggcaataaaactatcaag
aatagaattgctcatttgccaaccactagaaatcgtgctactgatgatcatgtacccact
gatttaatgaaaaaatactacacagaccgtgctaaaagtggatctttattaatcaccgaa
gccactttaatctcattagatcaaggtgtttaccctaatgttcctggtatgtggaataaa
caacaaaaggatgcttggaaagaaatcaccgactcagttcattctattggtggcaccata
gctatccagttatgggctttaggtagagttggtaatgccaaattgttgaaagatgaagga
ttaccattaactggagtcagtcctatttatgaacacgaaaaggctgaacaagatgcaatt
gatgcaggcaacccaattcaagaattgactcaagatcaaatcaaagatattgtttataat
cagtttgccaacgcagtcaaattagctgatgaagcaggttttgattttattgaattgcac
ggtgccaatagttatttgtttgagcaattcattcatcctggaaccaataagagaactgat
aaatacgggggatcaattgaaaatagagccagatttttatttgaagttgttgatcatgta
tccacaattgttgatcctgctaaattggcaatcagattatcacctttaaacaattttcag
gttccatttgtaaacccagaaggacaagaagattattcttacatcgttgaaggtttacag
aagagagcagatgaaggtaaaggtcttgcattcattgatgttgttgaaggacgattcaca
tctgatggaggtactgaaggttgtaatgtagattttgttggtgaaatttggaaaggtcca
ttgttaaaaggaggcaattatacttatgatagaaagaacgagtggaaaacaattgaaaac
gatgccaatgcagatgatagaacgttggttggctttggcagatatttcattgctaaccca
gatttacctgctagaatccaaaagggcaatgaattgaatgattatgatagatcaacattc
tacaatactgatgattatggttataatacctatccattttatggagaggaaaataaggct
gaccctaatattaaagtattaggcgtggctttagcttag

DBGET integrated database retrieval system