KEGG   Candida albicans: CAALFM_C208360CA
Entry
CAALFM_C208360CA  CDS       T00189                                 

Gene name
OPT5, CaO19.5121
Definition
(RefSeq) Opt5p
Organism
cal  Candida albicans
SSDB
Motif
Pfam: OPT
Other DBs
NCBI-GeneID: 3640768
NCBI-ProteinID: XP_717657
UniProt: Q5A741
Position
2
AA seq 921 aa
MSTEKPIPALPVTSITSHVDVAAHEVNLQAITSNPLSIGEVGTTLTNGQKDFILKRLHYD
SLVSFDKLPPQATFIFEKIEHISIEEALAILEKAVVEHENDVNILDNDEELWTKLINYKQ
GKIPSDTDFSEKAHPSNFTAKDKLSAFIHEKRVSEETSSLDNSASENLNEPYYKIVDWEL
QVKLEAVLIAYWSPYPQVRGVTDPYDDPTIPVETVRVYIVAIIWTAIGAVINQFFSERQP
SIGLGMSVVQVFLYPTGLICEWILPKWKFKVWKYTIDLNPGPYTFKEQMLATIFCGVSSG
TSYVSSNILMQKSELFYDNKWVDFGYQVLLTLSTNFLGFGLSGIMRQFAVYPEKAIWPSI
LPNVRLNKTLMSPEVKARINGWSISGYNFFFITAGISFLYFWIPDYLFQALSQFNWMTWI
KPDNYNLAVVTGSFGGLGLNPIPSFDMNVIGTGGFIAPFYNTLESYIGMVLALFCILGVF
YSNYKWTGFLPINSNRLFTNEGKPYHVTAVVNSNSLFDEEKYKEVGPPFYSAGNLVLYGA
FFAIYPFHFVYEIAMNYKQMWEALQSLYKGIRNFKRSTYEGFDDPHSVMMRAYPEVPEWA
YLIILVISLVLAILCVKLYPAETPVWGIFFALAINFVFLIPLTTVQSRTMFGFGLNVLVE
LIVGYAIPGNGLALAFIKALGYNIDGQAQNFINDLKQGHYAKLPPRAMYRCQLLSVFITS
FIQLGILNYQITGIKDYCVPGNKQKFTCPGTTTFYNASVLWGVIGPKKVFNGLYPILAWC
FLIGFLLAFPCIAFKKWAPRKYSKYFEPSIIIGGFLGYAPYNLSYNTGGLYVGYAFMHYV
KRKYEAWWQKYDYLLATGIDAGIAFSSIIIFFAVMYHEKDISWWGNNVPFEGWDASMTNG
YLNATLQAPDGYFGPRVGHFP
NT seq 2766 nt   +upstreamnt  +downstreamnt
atgtctacagagaaaccaattcctgctcttcctgttactagtatcaccagtcatgttgac
gtggctgctcatgaagtgaaccttcaggcaataacatcaaaccctctttctattggcgaa
gttggtactacattgacaaatggtcaaaaggatttcatccttaaaagattacattatgat
tcgttggtttcttttgataaattgccacctcaagcaacatttatatttgagaaaattgaa
catatttccattgaagaagctttagctatattggaaaaggctgttgttgaacatgaaaac
gatgttaatattttagataacgatgaagagttgtggacaaagttgatcaactataagcaa
gggaaaatcccttcagatactgacttttctgaaaaagcacatccatctaatttcactgca
aaagacaaattgtcggcattcattcatgagaaaagggtatcagaagaaacctcatcatta
gacaacagtgccagtgagaatcttaacgaaccttattataagattgtcgattgggaattg
caagtcaaattagaagcagtgttgattgcttattggtcaccatatccccaagttagaggt
gtgactgacccttatgatgatccaacaatccctgttgaaactgttagagtttatattgtc
gctattatttggactgctattggtgctgttattaaccaatttttttctgaaagacaacct
agtattggacttggaatgtcggttgttcaagtgttcctttatccaactggtttaatatgt
gaatggattttacccaaatggaaatttaaagtttggaaatacactattgatttaaaccct
ggtccatatacttttaaggaacagatgcttgctactattttctgtggtgtttcttctggt
acttcgtatgtatcatctaacattttgatgcaaaaatcagaattattttatgataacaaa
tgggttgatttcggttatcaagtattgttaacattgtcaacaaactttcttgggtttggg
ctttctggaataatgagacagtttgctgtttatccagaaaaggcaatttggccatcgatt
ttacctaatgtcagattaaataaaactttaatgtcgcctgaagtgaaagcaagaatcaat
gggtggagtatttctggttataatttctttttcatcactgctggtatttcatttttatat
ttttggattcctgattatcttttccaagcgctttctcaattcaattggatgacatggatt
aaacccgacaattataatcttgccgttgtgacaggttcctttggtggtcttggattgaac
ccaatcccaagttttgatatgaatgttattggtactggtggattcattgctccattttat
aatacattggagagttatattgggatggtacttgcacttttttgcatattaggtgtattt
tactcgaattacaaatggacgggatttcttccaatcaattcaaatcgtctttttacaaat
gaggggaaaccatatcatgttactgcggttgtgaattctaactccttgtttgatgaagaa
aaatacaaggaggtgggaccaccattctattctgctgggaacttggttctatatggggca
ttttttgccatttatccgtttcattttgtttacgaaattgcaatgaactataagcaaatg
tgggaagcacttcaatccttatacaagggtattagaaatttcaagagatctacttatgaa
ggttttgatgatcctcatagtgttatgatgagagcatatcctgaagttcctgaatgggca
tatcttatcattcttgttatttcattggtattggctatattatgtgtcaaattatatcct
gctgaaacaccagtttgggggattttctttgccttggcaatcaactttgtgtttttgatt
ccattaacaactgtgcaatcaagaacgatgtttggatttggtcttaatgtgttagttgaa
ttgattgttgggtatgctattccaggtaatggattggctttagcatttataaaagccttg
ggctataatattgatggacaagcacagaatttcattaatgatttgaaacaaggtcattac
gctaaacttccaccaagagcaatgtacagatgtcaattattgtctgtatttattacttca
ttcattcaattgggtattcttaattaccaaattactgggattaaagattattgtgttcct
ggtaataaacaaaaatttacatgtcctggaactacgacattctataatgcttcagtttta
tggggggttattggacccaagaaagttttcaatggattatatccaattttagcttggtgt
ttcttgatcgggttcttgttggctttcccatgtattgctttcaagaaatgggctcctaga
aaatactccaaatattttgaaccttcgattattattggtggatttttaggttatgctcct
tataatttgtcgtacaatactgggggtctttatgttggttatgcatttatgcattatgtc
aaaagaaagtatgaagcttggtggcagaagtatgattatctcttagctacagggattgat
gctggtattgccttttcatcaatcattattttctttgctgtgatgtatcatgaaaaagat
atttcctggtggggtaacaatgttccatttgaaggatgggacgcttcaatgaccaatgga
tatttgaatgctactttacaggcacctgatggttattttggtccaagagttggacatttc
ccatga

DBGET integrated database retrieval system