KEGG   Candida albicans: CAALFM_C209400CA
Entry
CAALFM_C209400CA  CDS       T00189                                 

Gene name
ERG24, CaO19.1598
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cal  Candida albicans
Pathway
cal00100  Steroid biosynthesis
cal01100  Metabolic pathways
cal01110  Biosynthesis of secondary metabolites
Module
cal_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CAALFM_C209400CA (ERG24)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CAALFM_C209400CA (ERG24)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 3647716
NCBI-ProteinID: XP_710679
UniProt: A0A1D8PIC7
Position
2
AA seq 448 aa
MKSSKLNPVTTHKEFNGISGALGITIGLPTLTVLFYLLCNQTYSIHGINVDFAKIKSQLP
ITQDELWQLVFDKTCWSAYLAWFFILVILDYLLPGKSLNGVKLRDGTVLNYKINGLSMSS
LLIVLLLARLFQSNSDSSLEYYLPELQFIYDNQLQLIIICFLFSFMLAVFVYIISFIPLA
KPNGIGTKERILSINGNTGNPFYDWFIGRELNPRIGSWDIKLFCELRPGMLLWLLINLSC
LHYQYHNLGYVTDSMIVVNLLQAFYIFDGVLNEEGCLTMIDITTDGFGFMLSFGDLAWVP
WTYSLQARYLSIKGNEVNLGWTLSLLIVGLQALGFYIFRSANKQKSDFRQGKLPHLKSIQ
TKTGSKLLVEGWWGLSQHINYLGDWLIGLSWCLPTGFQTPLTYFYVIYFASLLIHRQVRD
EMKCRAKYGEDWEKYEKLVPYKIIPYVY
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgaaatcgtcaaaattgaatccagtcacaacccataaggagttcaatggtatttctggg
gcgctaggtataacaattggattgcctaccctcactgtattgttctatttgttgtgcaac
caaacgtattcgattcatggaatcaatgtcgatttcgccaaaattaaaagtcaattacca
atcactcaagatgaattatggcagctagtatttgataaaacatgctggctggcctattta
gcttggtttttcattttggtcattttagattacttgttacctggcaagtcattaaatgga
gtgaaattaagagatggcactgttttaaattataaaatcaatggtttgagcatgagttcc
ttattaattgttttgctattggcacggttattccaactgaacagcgacagctctcttgaa
tattatttaccggaattacaatttatttacgacaatcaattacagttgatcattatttgt
tttttgttttcttttatgctagccgtatttgtatacataatttcgtttattccgttagcc
aaaccaaatggaattggtacaaaagaaagaattttgagtatcaatggtaatactggaaat
ccattttacgattggttcattggtcgtgaattaaacccaagaataggtagttgggacata
aaattgttttgtgagttacgccccgggatgttattatggttgttgataaatttgagttgt
ttgcattatcagtaccataatttgggctacgtaacagactcaatgattgttgtaaactta
cttcaagcattctacatattcgatggggtattgaacgaagaaggttgtttgacgatgatt
gacataaccaccgatggatttggttttatgctaagctttggtgacttagcgtgggttcct
tggacttattctttacaagcaagatatttgagcataaagggcaatgaagtcaacttagga
tggacattaagtttgttgatcgttggattacaggcattagggttttacatcttccgctca
gcaaataaacaaaaatcagattttagacaaggtaagttgccccatttaaaaagcatccaa
actaaaactggctcaaaattgttggtggaaggctggtggggcttgtctcaacacattaat
tatttgggtgactggttgattggattatcttggtgtttgcctactggctttcaaacccca
ttgacctacttttacgttatttactttgcttccttgctaatccatcgtcaagtaagagac
gaaatgaagtgcagagcaaaatacggcgaggattgggaaaagtacgaaaagctagttcct
tataaaataattccttatgtatattaa

DBGET integrated database retrieval system