KEGG   Candida albicans: CAALFM_C301300CAHelp
Entry
CAALFM_C301300CA  CDS       T00189                                 

Gene name
NCE103, CaO19.1721
Definition
(RefSeq) carbonate dehydratase
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
cal  Candida albicans
Pathway
cal00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CAALFM_C301300CA (NCE103)
Enzymes [BR:cal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     CAALFM_C301300CA (NCE103)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-GeneID: 3636621
NCBI-ProteinID: XP_721792
UniProt: Q5AJ71
Structure
PDB: 

Position
3
AA seq 281 aa AA seqDB search
MGRENILKYQLEHDHESDLVTEKDQSLLLDNNNNLNGMNNTIKTHPVRVSSGNHNNFPFT
LSSESTLQDFLNNNKFFVDSIKHNHGNQIFDLNGQGQSPHTLWIGCSDSRAGDQCLATLP
GEIFVHRNIANIVNANDISSQGVIQFAIDVLKVKKIIVCGHTDCGGIWASLSKKKIGGVL
DLWLNPVRHIRAANLKLLEEYNQDPKLKAKKLAELNVISSVTALKRHPSASVALKKNEIE
VWGMLYDVATGYLSQVEIPQDEFEDLFHVHDEHDEEEYNPH
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgggtagagaaaatattttgaaatatcaattggaacatgatcatgaatctgatcttgtt
actgaaaaagatcaatcattattacttgataataataacaacctaaacgggatgaataat
accattaaaactcatccggtacgtgttagttcaggaaatcataataattttcctttcact
ttatcttcagaatctacattacaagattttttaaataataataaattttttgttgattcc
ataaaacataatcatggtaatcaaatatttgatttgaatggtcaaggtcaatctcctcat
acattatggatagggtgtagtgattcaagagcaggtgatcaatgtttagctacattacca
ggagaaatatttgttcatagaaacattgctaatatagtcaatgccaatgatataagtagt
caaggggttatacaatttgctattgatgtattaaaagtgaaaaaaatcattgtttgtggt
catactgattgtggtggtatttgggcatcattatcaaagaaaaaaattggtggtgtttta
gatttatggttaaatccagttagacatattcgtgctgctaatttaaaattattagaagaa
tataatcaagatcctaaattaaaggccaaaaaattggctgaattaaatgtcatttcttct
gtaacagcattgaaaagacatcctagtgctagtgttgcattaaagaagaatgaaattgaa
gtttgggggatgttatatgatgtggcaactggttatttatctcaagtagagattcctcaa
gatgaatttgaggatttattccatgttcatgatgaacatgatgaagaagaatataaccct
cattga

DBGET integrated database retrieval system