KEGG   Candida albicans: CAALFM_C400680WAHelp
Entry
CAALFM_C400680WA  CDS       T00189                                 

Gene name
CaO19.4174
Definition
(RefSeq) nucleoside transmembrane transporter
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
cal  Candida albicans
Brite
KEGG Orthology (KO) [BR:cal00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cal02000]
    CAALFM_C400680WA (CaO19.4174)
Transporters [BR:cal02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   CAALFM_C400680WA (CaO19.4174)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 3645753
NCBI-ProteinID: XP_712628
UniProt: A0A1D8PL42
Position
4
AA seq 453 aa AA seqDB search
MSTDSTDSPATNNIHDPTIFQINGLLKIKLSQFKYFTFTVIGIALLWPWNCFLSASAYYG
ERFVNSPSLVKVYSSTMMSVSTITSTAYNFYLSQRQTNVNYNFRVQAGFCITIFVFLFMA
VSCVSDWIIDMNDSAFFTTLMFMVLLSAMATCLAQNGTMAIVNVLGGIYANAVMVGQAVA
GVLPACALIISILLVGDKVSDQHHRVEKNYGVFVYYITASLVCIISLLLLYLVTYHKNEV
GYQRLNQLVEEDDSGAVDEQEVVDPIHTQKKFVPFTVLWGKLNLIVMTIFFTFGITLIFP
VFASVVESVHTDSQSRFLNKNIYIPFIYLVWNLGDLLGRVLCGYPRLNMLIKSPKTQLVY
ALSRLVFIPLFLTCNIHPGQSEPFIKSDLWYIGLQLLFGISNGQLCTSAFMIVGDYCDTD
EEKEAAGGFTTVFLSTGLAVGSVLSYLLVLAVN
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccgatagcactgacagccctgctacaaataatatacatgacccaactattttc
caaatcaacgggttactcaaaatcaagctttctcaattcaagtattttacttttacagtt
attggtatagcgttgttatggccatggaattgttttctctccgcgtcagcttattatggt
gaaaggtttgtaaactctccttccttagtaaaggtttactcctcgactatgatgagtgtt
tccacaatcacctccacggcgtacaatttttacttgtcacaacgacaaacaaatgtcaat
tacaactttagagtgcaagctggattttgcattacaatatttgtgtttttattcatggct
gtctcatgtgtgtctgattggataattgatatgaacgactcggcatttttcactactttg
atgtttatggtgttgttgtcagccatggccacatgtctagcacaaaatggtaccatggct
atcgtcaacgttttaggtggtatttatgccaatgcagtgatggtgggtcaagctgttgct
ggggttttacctgcatgtgctttgattatatcaatattattagttggtgacaaggtgtcc
gatcagcatcatcgtgttgaaaaaaactatggagtatttgtgtactacattactgcaagt
ttggtgtgtataatttccttattgctactatatttggtcacttaccacaagaacgaagtt
ggctaccaaaggctcaatcaattagtagaagaagatgactctggcgcagttgacgagcaa
gaggtggtcgatccaatacacacacagaagaagtttgtaccctttactgtattatggggg
aaactaaacctaattgtaatgactatatttttcacgtttggaataaccttgatatttcct
gtctttgcatcggtggtggaatctgtgcataccgattctcagtcaagatttctcaataag
aacatttatataccgttcatatacttggtttggaaccttggtgatttgctaggtagggtt
ctttgtgggtatccaagactaaatatgttgatcaagagtccaaaaactcaacttgtttac
gcgttatcgcggttggtatttatccccttgtttttgacatgtaacatacacccgggccag
tccgagccatttataaagtcagacttgtggtacattggtttacagttacttttcggaata
tcaaatggtcaattgtgtacctctgcatttatgattgtcggagactattgtgatacagat
gaagaaaaagaggcagctggtgggtttacaacagtgttcttaagcaccggcttagcagtc
ggtagtgtattgagctatttattagtgttggcagtaaactaa

DBGET integrated database retrieval system